SecReT6
Protein ID: 525853577
SecReT6 ID826
T6SS typei5
Gene symbol-
Locus tagM636_04590
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome II [GenBank: NC_021822] [Browse all T6SS(s) in this replicon]
Location [Strand]1009626..1013144 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDS5J680
KEGG IDvpk:M636_04590
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.70E-87, Aligned region: 502..805
ImcF-related_N [PF14331], Evalue: 2.90E-86, Aligned region: 190..452
DUF1215 [PF06744], Evalue: 1.50E-38, Aligned region: 919..1034
AAA_16 [PF13191], Evalue: 0.0041, Aligned region: 40..115
AAA_16 [PF13191], Evalue: 0.0041, Aligned region: 125..192
AAA_19 [PF13245], Evalue: 0.0052, Aligned region: 127..142
Protein Sequence: 1172 a.a.     [Download]
>gi|525853577|ref|YP_008270161.1| type VI secretion protein IcmF [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSIKEIGRVFTQRWFLGLVGVAACSIFIWVVGPLITVAGYEPLKSDFQRLVTILVIVFAWALINLTKQHK
QKVREDESIQTLLEVDSQSDKEAASEIDVMRDRIEQAIKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTV
LKQSGLEFPLAESLGADSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYR
TQRPINGAIVTVSLASVMSQTRTERSLHARSIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFADLS
KEEREELFGFMFPREVDDERGVISLFNKEFHGMLERLDARMLRILETEDDLEKRTLIFEFPKQLRVLQAN
LDEFLSEIFAQNTFEEPALIRGVFLLSSVQEGIPVDRLMSESTNGLGLGRLPLATNVNSSHSYFVKNLFE
RVIFKEQLLGTVNRHYQKQSGWMRTGIYVGCVGVLVGASALWFLSYQWNSKLIVDTNSQANHIEAMIGAE
SLDFESDVISAVDTLDKIMMLPLGKNSEYGHSDAVKKFGLYQGDKVSQAANNAYSDALSQHFATLLSESL
VSEMEANKQHREYLYETLKTYLMLFNPEKYQQEEVIAWFNFYFERQYPGELNKELRERLLVHTKNLLEND
EKGFSMDATAISAAREVLTQMSLPERAYQRMKMQFAKSHVPSFRLTDVLGPKGLEQFERASGKPLSQGIS
GFYTYNGFHSIFQIQINRTVKGLMEENWVYGDDLKAHEIDHDSAIQGVQARYYQDYVNEWKTLIEDVQLK
QAPSLALATEQSRVLSGVERPIESLLRAIQKEVGLSKVTLSENQKAATEVAGKVAKVKFSNTADKLDMYL
PEENGFNVALPGKEVESHFTEILRLSEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDV
AASFARAKDLLPKPFNQWLGELSQESVKFAERGSKDHLNQLWVTNVVRPYQRTIAGRYPFEPNATKEVRL
KDFQRFFGYGGTLDSFFQEYLEPFVDTSKSRWRLEKEIGVRPETLAVFQRAKRIRQSFFESDNSLRVEFG
MKPVYLDQHITRFVLELGDQDLVYKHGPARSKELRWPSGQDQTRIVFTPPESKREIAHTYEGEWGIFKLL
DQSLKARPESRNDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPQTL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|525852846|ref|NC_021822.1|:c1013144-1009626 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome II, complete sequence
ATGAGTATTAAAGAAATAGGCAGAGTATTTACCCAAAGATGGTTTCTTGGTTTAGTTGGTGTAGCCGCGT
GCTCCATTTTTATTTGGGTTGTGGGTCCTCTGATCACGGTTGCAGGTTACGAGCCGCTTAAAAGTGATTT
CCAACGTTTAGTTACGATCTTAGTGATTGTTTTTGCTTGGGCGCTTATCAACTTAACAAAGCAGCACAAA
CAAAAAGTTAGAGAAGACGAAAGTATTCAGACGTTGCTTGAAGTAGACAGTCAGTCAGACAAAGAAGCCG
CCAGTGAAATTGACGTAATGCGCGATCGTATAGAGCAAGCGATCAAAGTTGTGACAAAAACGCATAAAGG
AAAGCGTAGTTTGTACGATTTACCTTGGTACGTTCTGATTGGTCCTCCTGGAACAGGTAAAACCACGGTT
CTAAAGCAATCTGGCTTGGAATTTCCGTTAGCTGAGAGCTTAGGAGCTGACTCTATAGCTGGTGTAGGTG
GAACACGTCACTGTGATTGGTGGTTTGCTAATAAAGCAGTACTTATTGATACAGCAGGACGTTACACCAC
GCAAGATAGTCAAGAAAAGGTTGACTCTAAAGCTTGGCACGGTTTCTTGGGGTTGCTTAAGAAATACCGC
ACTCAAAGGCCTATCAATGGCGCTATCGTTACAGTCAGCCTAGCAAGTGTGATGTCTCAAACTCGTACAG
AACGTAGCTTACATGCCAGATCAATAAAATCTCGCCTTCAGGAACTAAAAAATCAGTTGGGTATGCAATT
CCCAATCTATGTTCTGCTGACGAAAATGGATCTGGTTGCTGGCTTTAATGAATTTTTTGCTGATTTAAGT
AAAGAAGAGCGTGAGGAACTTTTTGGATTTATGTTCCCACGAGAAGTTGATGACGAACGTGGTGTCATTT
CTCTCTTTAATAAAGAGTTTCACGGCATGTTGGAGCGGCTCGATGCGCGCATGTTACGTATATTAGAAAC
TGAAGATGACTTAGAAAAGCGCACGCTAATATTCGAATTTCCAAAACAGCTGCGAGTTTTACAAGCAAAC
TTAGATGAGTTTTTGTCTGAGATATTTGCGCAGAACACGTTTGAAGAGCCAGCCCTTATTCGCGGTGTTT
TCTTGCTTAGCTCTGTACAAGAAGGTATTCCTGTTGATCGACTGATGAGTGAATCAACTAATGGATTGGG
ACTAGGGAGGTTGCCTTTAGCGACAAACGTTAACAGTTCGCATAGCTATTTTGTTAAGAATCTTTTTGAG
CGAGTCATCTTTAAAGAGCAATTACTAGGTACCGTTAACCGCCACTATCAAAAGCAATCTGGATGGATGC
GTACGGGCATATACGTGGGTTGTGTTGGTGTTCTTGTTGGTGCTTCAGCTCTTTGGTTCCTGAGTTATCA
ATGGAATTCAAAGTTAATTGTCGATACCAATAGCCAAGCAAATCATATTGAAGCGATGATAGGTGCAGAG
AGCCTTGATTTTGAATCGGACGTTATCAGTGCTGTAGACACGTTAGACAAGATCATGATGTTGCCACTAG
GGAAAAATAGTGAATATGGTCATTCTGATGCAGTGAAAAAGTTTGGTCTGTATCAAGGTGACAAAGTTTC
TCAAGCAGCAAATAACGCGTATTCAGATGCTCTTTCTCAACACTTTGCTACTCTGCTGTCAGAGAGTTTG
GTCTCGGAAATGGAAGCGAATAAGCAGCATCGTGAATACTTATACGAGACGTTAAAGACGTATTTAATGT
TGTTTAATCCGGAAAAGTATCAACAAGAAGAGGTAATTGCTTGGTTCAACTTCTACTTTGAACGTCAGTA
TCCAGGAGAGTTAAACAAAGAGCTACGTGAGCGTTTGCTAGTGCATACTAAAAACTTACTAGAGAACGAC
GAGAAAGGCTTCTCAATGGATGCGACTGCTATTAGTGCAGCACGAGAAGTTCTAACGCAAATGTCACTTC
CAGAGCGTGCATATCAGCGAATGAAGATGCAGTTTGCTAAAAGTCACGTTCCGTCTTTCCGTTTAACAGA
TGTGTTAGGACCTAAAGGTTTAGAACAATTTGAGCGAGCAAGTGGAAAACCTCTATCGCAAGGTATTTCC
GGTTTTTATACCTACAACGGTTTTCACAGCATTTTCCAAATTCAGATTAATCGCACCGTCAAAGGATTGA
TGGAAGAAAACTGGGTGTATGGGGATGATCTTAAAGCTCATGAAATTGATCATGATAGTGCTATTCAGGG
GGTTCAAGCCCGCTATTATCAAGATTATGTCAATGAGTGGAAAACTCTGATAGAGGATGTTCAGCTTAAA
CAAGCTCCGAGTTTGGCTTTAGCAACAGAGCAATCAAGAGTTTTATCCGGTGTAGAAAGACCAATTGAAT
CACTTCTGCGTGCAATACAAAAGGAAGTGGGGTTATCGAAAGTAACGTTATCGGAAAATCAAAAGGCAGC
AACGGAAGTCGCAGGAAAGGTTGCAAAAGTGAAGTTTTCTAATACGGCCGACAAACTCGATATGTATTTG
CCTGAAGAGAATGGATTTAATGTTGCTCTACCAGGTAAAGAAGTTGAATCCCATTTCACCGAAATCTTAC
GACTTAGTGAACAAGACTTTGATGATATTCAGCAAGCGATGGTGAATTTGCGTTCGTACTTATCTGATTT
GTCTAGCTCTGGCAACAATCAAAAAATTGCTTACAAAAGCATATTGGATGGAACGGTGACTCAGGATGTT
GCTGCCTCCTTTGCTAGAGCAAAAGATCTCTTACCAAAACCGTTTAATCAATGGTTGGGAGAGTTGTCAC
AGGAATCGGTTAAGTTTGCAGAAAGAGGCTCTAAAGATCATCTAAATCAGCTTTGGGTGACTAATGTAGT
GCGTCCTTATCAGCGGACTATAGCAGGTAGATACCCATTTGAACCTAATGCAACGAAGGAAGTTCGTCTA
AAGGACTTTCAACGATTCTTCGGGTACGGTGGTACGTTGGACTCGTTCTTCCAAGAATATCTGGAGCCGT
TTGTTGATACGTCTAAGAGTCGTTGGAGACTAGAAAAAGAAATCGGTGTAAGGCCCGAGACGCTTGCAGT
TTTTCAAAGGGCAAAACGCATTAGACAATCGTTCTTTGAATCAGATAACTCGCTACGAGTCGAGTTTGGT
ATGAAACCCGTATATCTAGATCAACACATTACTCGATTTGTGCTAGAGCTAGGTGATCAAGACTTGGTTT
ATAAGCACGGTCCTGCGAGATCGAAGGAACTTCGCTGGCCATCGGGTCAAGATCAGACGCGTATTGTGTT
TACACCGCCCGAATCAAAACGAGAAATTGCTCATACCTATGAAGGGGAATGGGGCATTTTCAAACTATTG
GACCAATCACTCAAGGCTCGACCAGAGTCCCGCAACGACAACATTGTCATGATCGATTTGAAGGGGAACA
AGGTTCAGCTTGAGTTGATTCCATCTAGTGCAATCAACCCATTTTGGTCTAATGAGATGGAGAGGTTCAG
ATGTCCGCAAACCTTGTAA
 Primer design