SecReT6
Protein ID: 525958483
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14770
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1381079..1381885 [-]
Producttype VI secretion protein
NoteTssL
UniProt IDS5JDH6
KEGG IDvpk:M636_14770
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-55, Aligned region: 51..253
Protein Sequence: 268 a.a.     [Download]
>gi|525958483|ref|YP_008316303.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MGSSSMSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLNIENMGINPLVDQFSWLIASLSCMSSI
PWLDDPMPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFH
NETSGGDKFFVILERLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGNTIYRLVRDERLAE
QEKVSLVNLKAKYLKKPLKRVISPKLILGISAITFAIMYAATYIVIDLKFQQLLEVYR
 
Nucleotide Sequence: 807 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1381885-1381079 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGGGCAGTTCGTCTATGAGTTACGCAGAAACTGACGTTACTGTAGTCTTATTCCAACCAGAGCCAGGCA
AACCGATGGAGGTGATGCCAGCGCCTGACTTGTCTCGTAATATCGCGGTACAAGACCTAAACATCGAAAA
CATGGGCATCAACCCGTTGGTCGACCAGTTCTCATGGTTGATCGCCAGTTTGTCTTGTATGTCTTCGATT
CCTTGGCTTGATGACCCAATGCCGTTTCGTGAACAAGTGGCTCGTGAGATAAGAAAAGGCGAGCGTAAGC
TCAATGAAATGGAACTGGATCGCGCATCCATTTTGGTCATCCGCTACTGTTTGTGTGCTGCGATTGATGA
GTCGGTCTGCCGACAAGAGTGGGGCGCTAACAGCCATTGGAGCCAGAACAGTTTGCTGTCAGAGTTCCAC
AATGAAACATCTGGCGGTGATAAGTTCTTCGTTATTCTCGAGCGATTAAAAGCAGACCCGCGCAAATACC
GTCACGTTATCGAGTTTCTGTATTTGTTGCTTCAACTTGGCTTTCAGGGCAAATACGGCCGTGAAGAGCG
CGGTAACGAAAAGCTAGCAGAAATCGGCAATACAATTTATCGCTTAGTACGTGATGAACGCTTAGCAGAG
CAAGAGAAAGTCTCTCTCGTTAACCTTAAGGCCAAATACCTTAAGAAGCCGTTAAAAAGGGTGATTTCAC
CCAAACTGATTTTAGGCATCAGTGCGATTACCTTCGCAATCATGTATGCCGCGACTTACATCGTCATAGA
TTTAAAGTTTCAGCAATTACTTGAAGTGTATCGATAA
 Primer design