SecReT6
Protein ID: 525958484
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14775
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1381867..1383192 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDS5JN54
KEGG IDvpk:M636_14775
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.00E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|525958484|ref|YP_008316304.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTLESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDESFIPTCIDIHASTVLNKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASAEGVHPESFYRILLQAEGELSTLCSASRRP
IEFTKYNHGDLTSCLSRTLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDSKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWAALKNTAA
IAVHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1383192-1381867 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCACTTTCAGCAACTCG
ATCGTTCACAAAGTAAACTGTCGAGCATGCTGAGCGCAAATGCATCACCTTTGCATTGGGGCATTAAGCG
CTTAGAGATTAACTCGCAACTACTGGCGTTGGGCAAAATTGGTATCACTCGTGCTGAAGGTATTCTTCAA
GACAGAACACCATTTGAGCTGCCGCTGCTGGCTGAACTTCCAGAAGTGAAAGACGTTGATCCTTCGATTG
CTGACAAAGTGGTTTACCTTTGTTGTCCGTTACCTTCTGAGCGCTCTGAACTATTCGGCACCAAGAAAGA
CGGCGCACGTTACACACTGGAATCTCAAGAGGCGGTTGACGCTTGTTATGATTCAGAAGACATGGCAAAT
ATCGTAGTCGGTAAGCTTAACTTCTGCTTGATGTATGACCATGAAGATAAGAGTGCTTACACATCAATTC
CAATTCTGAAGATCTCAGAAGTGAAGCCAGACGGCAGTGTTATCTTGGATGAAAGCTTTATCCCGACTTG
TATCGATATTCATGCCTCTACCGTGCTAAACAAGTTCGCAACCGAGTTTGCCTCTATGCTGAAACACCGC
GCAGAATCCATCGTTCAGCGCTTAGGCGTGGTTGACCAGCAAGGCGTATCTTCAGTTTCTGATTTCATGC
TGCTGCAAGCTCTAAACCGATACGAGCCGCTATTCTGGCACTTTGCGAGCGCAGAAGGGGTTCATCCTGA
ATCGTTTTATCGCATTCTTCTTCAAGCGGAAGGTGAGCTTTCGACTTTGTGTTCAGCATCTCGTCGACCA
ATCGAGTTCACCAAGTACAACCATGGCGACCTAACCAGCTGTCTATCGCGTACATTGGATAGTGCGAAGA
TGACACTAAGTGTGATGTCTGAGCAGCGTGCAATCCCACTGACGTTGAAAGACCAAAACTACGGTATTAG
AACGGCAGCGATTCCAGACAGTAAGATTATCGACACCACGACCTTTATTCTTGCGGTTAAAGCCGACGTT
ACTTTGGATGTTCTTCACACCCAGTTTGTTAGTCAAACGAAGATCGGTTCTATCGATAACATTCGTGACT
TGATTAACCTGCAACTGCCGGGCATCGAGATTAAACCAATGCCAGTCGTACCTCGCGCATTGCCTTACCA
CGCAGGTTACACCTACTTCGAACTGGATAAGACTGGCGAAGAGTGGGCAGCACTGAAAAACACGGCTGCA
ATTGCGGTTCACGTAGCCGGCGACTTTGCTAACTTGTCGCTGCAACTATGGGCAGTTCGTCTATGA
 Primer design