SecReT6
Protein ID: 525958485
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14780
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1383204..1383704 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDS5J7H5
KEGG IDvpk:M636_14780
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-34, Aligned region: 10..152
Protein Sequence: 166 a.a.     [Download]
>gi|525958485|ref|YP_008316305.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MRSIAILLGCALLSGCAMWDQFKESTGITPETSSIELVIEASSVLNVREGGQSSPVILRVHELTSPVLFR
SLDFFALFENDKASLGDEYIKRYEYQMQPGEKIHEFLELDPATRAVGFSVAFRDIDGSSWRKVEVIEEKS
EYYIKLKLEGSELISDNTRGIEQVYF
 
Nucleotide Sequence: 501 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1383704-1383204 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGCGTAGTATTGCAATATTGCTCGGATGCGCCTTGCTATCCGGTTGTGCCATGTGGGATCAATTTAAAG
AATCAACAGGCATCACGCCTGAAACGTCCTCGATTGAGTTGGTGATTGAGGCATCTTCGGTTCTAAATGT
TCGTGAAGGCGGACAATCCTCCCCGGTTATTTTGCGAGTTCACGAACTGACGTCACCAGTGTTGTTTCGT
AGCTTAGACTTCTTCGCATTGTTTGAGAACGATAAAGCATCACTGGGTGATGAATACATCAAACGTTATG
AATACCAAATGCAGCCTGGTGAAAAGATCCACGAATTTTTGGAACTCGACCCAGCAACCCGTGCGGTTGG
ATTCTCAGTCGCGTTTCGCGATATTGACGGTTCTTCTTGGCGTAAAGTCGAAGTGATTGAAGAGAAGAGC
GAGTACTACATAAAACTCAAGTTAGAAGGCAGTGAGTTAATTTCTGACAACACTCGCGGCATTGAACAAG
TTTATTTTTAA
 Primer design