SecReT6
Protein ID: 525958486
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14785
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1383697..1385205 [-]
Productsignal peptide protein
NoteFha
UniProt IDS5JSW7
KEGG IDvpk:M636_14785
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.10E-16, Aligned region: 31..97
Protein Sequence: 502 a.a.     [Download]
>gi|525958486|ref|YP_008316306.1| signal peptide protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MQTHQLVLFISKCPEEYTGAKHIEMPEGGGSVGRAPSCTLSLTDHNRFISGTHCLISVYGDTFYISDVST
NGTMVNGNKILKNQPISIVDGDVVSLGQYEIGVALEHISAVQDIAADIAPERVSNDPLVNLGEAVVEEEE
KVGSLEDLFMETKQDGVNTDDPIAHLKFSMQREDDYLIRDVEKPEPAKTIENTRQVVDDSFSIHSEFDIP
NLIPEDWLGGVATSKESVEPATEQAKQAAFIPEDFAHTKPVSPQASVVQPDVNQPQQPQYEAPLNHATSN
VTQRAEPVSQKWEEVTQAFVPSAQPTQPETKAKEAQQGFVSNESLAIESAAHSSDIGKAFYEGLGISNPD
LISNEALLFKQMGACLRLCIDNLQKDLHEVESLKGEQGLSEADSNLAELMLTLNSQNLLSPNELVEQMLD
ELNDHQIIFNKALNELLIEQSETNDPVTFANDVASKSMFTTKSKLWGEYLEFYANNRRQMNETSLKGLIK
KNYTKAIKGSHA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1385205-1383697 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGCAAACACATCAGCTAGTCCTATTTATTTCTAAATGCCCAGAGGAATATACGGGCGCAAAGCATATTG
AAATGCCAGAAGGTGGTGGCTCAGTTGGACGAGCGCCTAGCTGCACTCTGTCTTTAACGGACCATAACCG
TTTTATCTCTGGTACACACTGTTTGATAAGTGTATACGGTGACACTTTCTACATTAGCGATGTGTCGACA
AATGGCACTATGGTTAATGGTAATAAGATTCTAAAGAATCAACCGATATCTATTGTTGACGGTGACGTTG
TTTCATTAGGGCAGTACGAGATTGGCGTTGCATTAGAGCATATATCCGCTGTTCAAGATATTGCCGCCGA
TATTGCCCCAGAAAGAGTATCGAATGATCCACTCGTCAATCTCGGTGAGGCGGTTGTAGAAGAGGAAGAA
AAAGTCGGTTCATTAGAAGACTTATTCATGGAGACCAAGCAAGACGGTGTTAATACTGACGATCCTATTG
CGCATCTAAAGTTTTCGATGCAGCGTGAAGACGACTATCTTATCCGCGATGTTGAAAAGCCTGAGCCGGC
TAAGACAATCGAAAATACGCGACAAGTCGTTGATGACAGTTTCAGTATCCATTCCGAATTCGATATTCCA
AATTTAATCCCTGAAGATTGGCTGGGAGGCGTTGCCACGAGTAAAGAATCTGTTGAACCAGCGACAGAGC
AAGCTAAGCAAGCCGCGTTCATTCCAGAAGATTTTGCGCACACGAAGCCCGTTTCGCCTCAGGCTAGTGT
GGTTCAACCAGACGTTAACCAACCTCAACAGCCTCAATATGAAGCGCCACTTAATCATGCGACGTCAAAT
GTTACTCAAAGAGCAGAGCCTGTTAGCCAGAAATGGGAAGAGGTAACACAAGCCTTTGTTCCATCAGCAC
AACCTACTCAGCCAGAAACGAAAGCGAAAGAGGCCCAACAAGGTTTTGTAAGCAACGAGTCTCTAGCGAT
TGAGAGTGCGGCTCATTCTTCAGATATCGGTAAAGCATTTTATGAAGGCTTGGGTATTAGTAACCCTGAT
CTGATCAGTAACGAAGCTCTGCTGTTTAAACAAATGGGGGCATGTCTTCGTTTGTGTATAGATAACTTGC
AAAAAGACTTGCATGAAGTTGAGTCACTTAAAGGTGAACAGGGTTTAAGCGAAGCGGATTCAAACTTAGC
GGAACTGATGTTAACGCTAAATAGTCAGAACTTGCTGTCTCCGAATGAATTGGTGGAGCAAATGTTGGAT
GAGCTCAACGATCATCAAATTATTTTTAACAAGGCACTCAATGAGTTGCTAATTGAACAATCAGAGACGA
ATGACCCTGTCACGTTTGCAAACGACGTTGCAAGTAAATCCATGTTCACCACCAAATCAAAGTTATGGGG
TGAGTATCTTGAGTTCTACGCCAATAACCGTCGTCAAATGAATGAGACGTCATTGAAAGGTTTGATCAAG
AAAAACTACACCAAAGCGATTAAGGGAAGCCATGCGTAG
 Primer design