SecReT6
Protein ID: 525958489
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14800
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1387666..1391055 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDS5JN59
KEGG IDvpk:M636_14800
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-57, Aligned region: 153..411
IcmF-related [PF06761], Evalue: 7.50E-48, Aligned region: 209..231
IcmF-related [PF06761], Evalue: 7.50E-48, Aligned region: 498..755
DUF1215 [PF06744], Evalue: 9.90E-30, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|525958489|ref|YP_008316309.1| type VI secretion protein IcmF [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MFKQKILRNPVVVSTIVALVLAAIFAAVYLFILEDADKLYLWVGLGVITGFYFTFQLSLWLKKKNSSKVQ
RLETEEEALSMVIRPLLSNAGKKPIYLMVGNKGAGRRQFLFNSSAIKPMDRSRTAKNDFFEWYESDGAVY
VKPDQRLIFQEVSSSDASLWNTFIDEVIRHRPRKPFSGCLFFVDFEFMIVSEPEQKDYTMTALLQRLNSI
TEKTSSALPVYLMMTKLDKLDGFKEYVHSSSLKTRIEFLSIPLKEAKGVLTEYYLDSFHNLVKVLESNAL
DASANSTDISEKQAILAFPKQFELCQREISYVLERLCDTNNGVYSLDIREIFFCSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLLDSQILPESDFAGENKTYLRMIQRQSHLAMLASVVLLAGGTYFF
VTTLDSNLRVINQLLNIDEKVQTEQEASFNQLLQSATRAIQPSYNAWLEGSRALDEEIIPLNISRLNEST
KLAYEALIKEVAQQLMPVIERGYRFELTHNQHDVTATLPLLKGYLMLKDPTKRDIQFLRRQTLQTLTDLS
DKPDVVNQAMRYLDAYFRTQFSPVDINMDVVRATRRSLLANSNVDLVYAGILNQADAIDLGTLDLQRAVG
FEFNNVFNEPLDDNRLVIDKIYTSTGFSTFYRPRVDLMSKQVISDNWVLGLSSYVIPTKEEQESFKNQVR
KKYTDDYINYWRNALSELKIQSYSNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNVLISKVD
PKLAEVANSASEAVEEVVQPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETIAALSRVRTYMKDIADA
PDPQMAALAAAQHRMSSSEADPLIKLKQIAQKSPEPVRSWLLDVVKQSWSVMITESAKGIQTQWYSEIYT
KFKEIGLDKYPFDLTATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWVPKQVDGETMPLSSALLV
QLRNYNVIRDTLINKSTNRVYIPFSAKVLDLDSSAIRASLKISDTDINYYHGPSRIREMEWPPQNGDFNI
SITIQDVTDEGKQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|525957490|ref|NC_021848.1|:1387666-1391055 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGTTCAAACAAAAAATACTAAGAAATCCAGTCGTGGTTTCTACCATAGTGGCTTTGGTATTAGCCGCGA
TATTTGCAGCGGTATATTTATTCATACTTGAAGACGCAGATAAGCTTTATCTATGGGTTGGTTTAGGAGT
TATTACTGGTTTTTATTTTACATTCCAGCTTTCCCTATGGCTTAAGAAAAAAAACAGCTCAAAAGTTCAA
CGTTTAGAGACGGAAGAAGAAGCTCTTTCAATGGTGATCCGCCCTCTTCTTTCTAATGCGGGCAAAAAGC
CAATCTATCTGATGGTTGGTAATAAAGGGGCCGGTCGACGTCAGTTTTTGTTTAATTCCAGCGCAATTAA
GCCGATGGACCGTTCTCGCACAGCAAAAAACGATTTCTTCGAATGGTATGAATCTGATGGTGCCGTTTAT
GTTAAGCCAGATCAACGCCTCATCTTCCAGGAAGTTTCAAGCAGTGATGCTTCTCTCTGGAATACTTTTA
TTGATGAGGTGATTCGTCATCGTCCGAGAAAACCGTTTTCAGGTTGCTTATTCTTTGTTGATTTCGAATT
TATGATTGTATCTGAGCCAGAGCAGAAAGATTACACCATGACAGCGCTATTGCAGCGTTTGAACTCTATC
ACTGAGAAAACTTCGTCTGCACTACCTGTTTATTTGATGATGACGAAACTCGACAAACTAGATGGCTTTA
AAGAATACGTTCACTCTAGTTCACTAAAAACACGTATTGAATTTCTGTCCATTCCATTGAAGGAAGCGAA
AGGTGTACTTACCGAATACTACCTAGATAGCTTCCATAATCTGGTAAAAGTGCTAGAAAGCAACGCTTTA
GACGCATCGGCAAACTCAACAGATATCAGCGAAAAGCAAGCCATCCTTGCCTTCCCAAAACAGTTTGAAC
TCTGTCAACGTGAAATCAGCTACGTGCTTGAACGTCTTTGCGATACAAACAATGGCGTTTACTCGTTGGA
TATTCGCGAAATCTTCTTCTGTTCTTCTTTGCAAGGTGGACGCAAGTACAACTTGTTAGCCAAAAGCTGC
AGTAATTACTTCAATTTACCAATTATCGCATCTGAGCACACGCAACTAACTGAAACACCGTACTTTTCTC
GCTTCTTGCTTGATTCTCAAATCCTCCCAGAGAGTGACTTCGCAGGCGAGAACAAGACTTACCTACGCAT
GATTCAGCGTCAAAGCCATTTGGCAATGCTGGCATCCGTTGTCTTATTGGCAGGCGGTACTTATTTTTTT
GTCACAACACTAGACAGTAACTTGCGTGTTATTAACCAATTGCTAAATATCGACGAAAAAGTTCAAACAG
AACAAGAAGCAAGCTTCAACCAGTTATTGCAGAGTGCTACTCGTGCAATCCAACCCTCATACAATGCTTG
GTTAGAAGGATCACGAGCATTAGATGAAGAAATAATACCGCTAAATATAAGCAGGTTAAATGAAAGTACA
AAATTAGCTTATGAAGCATTGATTAAAGAGGTTGCTCAACAACTTATGCCTGTTATTGAGCGAGGCTACC
GTTTTGAACTGACACACAACCAACATGATGTCACAGCAACGTTGCCGTTACTAAAAGGCTACTTGATGTT
GAAGGATCCGACCAAGCGAGATATTCAGTTTTTACGACGCCAAACATTGCAAACACTGACAGACTTGAGC
GATAAGCCGGATGTGGTAAATCAAGCTATGCGATACTTGGACGCCTACTTCCGCACTCAATTCTCACCTG
TAGATATCAACATGGATGTCGTTCGAGCAACTCGTCGCTCATTGTTGGCAAATTCAAATGTGGATCTTGT
TTACGCAGGCATTTTAAACCAAGCAGATGCTATCGATCTTGGCACACTCGATCTACAACGTGCAGTTGGC
TTTGAATTTAACAACGTGTTTAACGAGCCGTTAGATGACAACCGACTAGTAATCGATAAGATTTATACCT
CCACTGGCTTTAGTACCTTCTATCGCCCTCGCGTCGACTTGATGTCTAAACAAGTGATCAGTGATAACTG
GGTGCTAGGATTGTCCAGCTATGTTATCCCAACCAAAGAAGAACAAGAATCGTTTAAAAATCAAGTACGT
AAAAAGTACACCGATGATTATATCAACTACTGGCGCAACGCTCTCAGTGAGTTAAAAATTCAGAGTTATA
GCAATGTGGGTGATCTAACAAATGCTATCGACCTAATCTCTGGACCATCTTCACCAATGACGACTGTATT
AAAGCAGGTCTATGCAAATACTCAGTTTTCACCGGTAGGAGAAAAAAACGTACTCATATCGAAAGTAGAC
CCAAAACTGGCAGAAGTGGCGAACTCTGCGTCAGAAGCGGTTGAAGAAGTGGTTCAGCCGGATTACTTGT
TGATGAAGCGTGTAGAACAAGCGTTCCATCTTCTAAATCAGCTTCAAGTAAGCGAGACTCCTAACTCCCC
TACTCCATGGGACGAAACTATCGCAGCTTTAAGCCGAGTTCGCACCTACATGAAAGATATTGCGGATGCT
CCCGATCCACAAATGGCAGCACTTGCAGCCGCTCAACACCGAATGAGCAGCTCTGAAGCCGATCCGCTAA
TTAAACTTAAACAGATTGCTCAGAAGTCACCAGAGCCAGTACGCAGTTGGTTACTTGATGTCGTAAAGCA
AAGCTGGTCGGTAATGATCACCGAATCAGCAAAAGGCATTCAAACCCAATGGTATAGTGAAATTTACACC
AAATTTAAAGAGATAGGACTTGATAAATACCCATTTGATCTCACAGCAACAGAGGAGATTTCTATCGAAG
ACTTCGAACTGTTGTTTGCTTCAGGTGGATTGTTAGACACATTTATTCAGAAAAACTTCGCACCGTTCTA
CGATACCAACTTGTGGGTACCAAAACAGGTGGATGGTGAAACAATGCCATTATCTTCAGCCTTACTGGTG
CAATTGCGCAATTACAACGTTATCCGCGACACGCTGATCAATAAGAGTACTAACCGAGTTTATATTCCAT
TCAGTGCGAAAGTATTAGATCTTGACTCAAGTGCTATCAGAGCCAGTTTGAAAATTTCTGACACTGATAT
CAACTACTATCACGGTCCGAGCCGAATTCGTGAAATGGAGTGGCCACCGCAAAACGGCGACTTCAACATT
AGTATCACGATCCAAGATGTGACAGACGAAGGTAAACAACACGTTTTAAATAAGAGTGGTCAATGGGCGA
TATATAGATTGCTAGGTGATTCGACCCTGACAAACACTCATAACGGTAGCTTCGTTAGTGACATAAAAGT
ATCAGGGAGGGATTTGAGCCTCCGTATAACTCCCTTGACACAAAAAAACCCTTTCACTTTGGCTGAGTTG
TACAACTTTACGCTCCCAGAGTCGATTTGA
 Primer design