SecReT6
Protein ID: 525958491
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14810
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1391604..1392602 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDS5JSX3
KEGG IDvpk:M636_14810
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.80E-83, Aligned region: 8..317
Protein Sequence: 332 a.a.     [Download]
>gi|525958491|ref|YP_008316311.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MINTLSEKSNEFSFYQAVLLLEKHYQFEPNSNFVAVGENKYFHQERIEFSVSPNLCFPKSDMEFIVHMER
SGQQYSRVETNFLGLHGSSSPLPASYTEKLTGREPDDNPVKDFFDFFHNRYTSLLYRVWKKYRYHVQYQS
GATDAFSGRMLHLAGLSGVMQDCGVAELDRAKVLSYVNQLSTRTRSPKLISGIVSHYFSLPSVRIEEWVY
RRVEIADSQRNKLNRANCILGQSFHLGQSIADLNGKFNLCIDDIDFETFKQFSYEGELHKTLVGLMRFIL
RDPMSWDLKLTVNLDSIPNNQLGNGEGNNLGQTFWLGNPTDEDVKIRVIGSI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1392602-1391604 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGATTAATACACTTTCTGAAAAATCGAATGAGTTTAGTTTTTATCAAGCGGTTCTTTTGCTCGAGAAGC
ACTACCAGTTTGAACCAAACTCTAACTTTGTCGCCGTGGGAGAGAACAAATATTTTCACCAGGAGCGAAT
TGAGTTCAGCGTGTCGCCTAATCTATGCTTCCCTAAGAGTGATATGGAATTTATCGTTCATATGGAACGA
AGTGGGCAGCAGTATTCACGAGTCGAAACGAACTTCCTTGGTTTGCATGGTTCGAGCTCTCCATTGCCTG
CCTCTTATACGGAGAAACTTACTGGGCGTGAACCTGATGACAACCCGGTAAAAGATTTCTTTGATTTCTT
CCATAATCGCTACACCAGTTTGCTCTATCGTGTCTGGAAGAAGTACCGTTATCATGTGCAGTACCAGAGT
GGTGCGACAGACGCTTTTTCTGGACGGATGCTGCACTTAGCTGGTTTATCAGGTGTTATGCAAGATTGTG
GTGTTGCAGAGTTAGACCGCGCAAAAGTCCTGTCTTACGTTAATCAACTATCGACACGTACACGTTCTCC
TAAGCTAATTTCAGGTATCGTTTCACATTATTTCTCACTTCCTAGCGTTCGCATCGAAGAATGGGTTTAT
CGCCGTGTGGAGATTGCAGACAGTCAACGAAATAAACTCAATCGAGCCAATTGCATATTAGGTCAGAGCT
TTCATTTAGGGCAGAGTATCGCAGATTTAAATGGTAAGTTTAATCTTTGCATTGATGACATTGACTTCGA
GACATTTAAGCAGTTTTCTTACGAAGGTGAGTTGCATAAAACGTTGGTTGGTTTAATGCGATTCATCTTA
CGTGACCCGATGTCTTGGGATCTCAAACTGACAGTTAATCTCGACAGCATTCCAAATAACCAACTTGGCA
ATGGAGAAGGGAACAACTTAGGGCAGACATTTTGGTTAGGCAATCCCACAGATGAAGATGTGAAGATCAG
AGTAATTGGTAGCATTTAG
 Primer design