SecReT6
Protein ID: 525958492
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14815
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1392599..1394347 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDS5JBH7
KEGG IDvpk:M636_14815
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-192, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|525958492|ref|YP_008316312.1| type VI secretion system protein ImpG [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSAIDVTLSTEHGLELSRIGLDTLRLHLHGEIHITRTVFLWLFRYLDYVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQELFSLPDKFMFFDITGLEWLKGIPQRSTVKIKFHFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGIVSSEMKPIDRVFRGVSVRGNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWKSLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1394347-1392599 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
TTGAGTAATAGTAAATACTTTCAAGATGAACTCACATATTTGCGCGAATCGGGTAGTGAATTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACATTCGACCCAGATGTCGAGCGATTGCTGGAAGG
TTTCGCTTTTCTGACTGGACGTATTCGAGAGAAGATCGATGACGAACTGCCAGAACTGACGCAATCTCTG
ATGACTTTGCTGTGGCCGCATTACATGCGTTCAATTCCATCTTTGTGCATCAGTGAGCTAAAACCTCATA
CGGGAAGTGTTACTGAGAAAACGGTGGTAAAACGTGGCGCAGAAATGGCCAGTGAGCAAGTAGAGGGTAC
GCAATGTCTTTTCCGCACTTGCTACGATGTGAATCTGTACCCAATCACGATCACCAACATTGAACAAACC
AACAGCCGCACCAGTTCAGCGATTGATGTGACGTTGTCGACGGAGCATGGCCTAGAGCTGTCTCGAATTG
GTTTAGATACGTTGCGTTTACACTTGCATGGTGAGATTCATATTACCCGCACTGTCTTCCTCTGGCTGTT
CCGTTACTTGGATTACGTGGAGTTGGATGTCGGTGGCGGCTATAAACATCGTTTAGGGCCAGAATATGTT
AAGCCGGTAGGGCATGAAGAAGACGAAGCGCTTCTGCCTTACAGCAAAAATTCATTCGCGGGTTATCGTT
TGCTGCAAGAATTATTCTCTTTGCCAGACAAGTTTATGTTCTTCGACATTACAGGTTTGGAGTGGCTAAA
GGGTATTCCACAACGAAGCACAGTGAAAATCAAATTTCACTTTAAACGCGCATTGCCGTCAGAGGTTGTA
CTTAAAGATAAGCACCTAAGGTTGCACTGCACGCCGGCGGTGAATTTGTTTGAAAAAGATGGCGACCCAA
TTCGTTTGGAGCACCGTCGTAACGAATACAAAGTCCGTCCTCAAAGTAATACGCAAGAGCACTATGAAGT
GTATTCCATTGAGCAAGTTGAGAGTTGGAGCAAAGACGAGCGTCGCCGTAAACCGTTAATCGAATTCGAA
TCGTTCGAGCATCAAATCAACCAACGAGACAAGCGAGAATTCTACAAGTCGAAGGTAGGAGAGCGTGTTA
GTGGAAGAGGGTTAGAGCGCTATATCTCGTTCCACACTCATAATGGTGATATTGCGGATTTAGGTACGGA
AACCGTACTCATGAAACTGCAATGCAGTAACGCTGATTTGGCCGAACGTCTTTCGGTCGGCGACATTACT
TACGCGACTCACAAATCGCCAACGTATGCGACATTTAAAAACATCACCAAGCCAACACAATCGGTAAGCC
CACAGGTAAACGGCGAGCTTCAATGGCAGTTGATTGCCAACATGTCGCTCAATTATTTGTCTTTGGCAAA
CATTGATGTATTAAAAGTGCTGCTCTCGACCTATGACTTTCATTCTCGTGTTGACAGACAAGCTCACCGA
GCATCGATTCACCGACTCGATGGCATTGTATCGTCAGAGATGAAACCAATTGACCGTGTATTCCGTGGCG
TGTCTGTGCGTGGTAACCAGTTCAAACTAGTAACCAACTCTAAGTTCTTCGTAAATGAAGGCGATATGTT
CCTGATGGCAACGGTACTGAACGAATTCATCCGTTTGTATTCGAGTGTAAACTCCTTTACCGAGCTAGAA
GTATTTGATGAGGCAACCGGCGAAGTATACAACTGGAAAAGCTTAATTGGGCAGCAGACGATTCTATGA
 Primer design