SecReT6
Protein ID: 525958493
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14820
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1394358..1394822 [-]
Producttype VI secretion protein
NoteTssE
UniProt IDS5JDI3
KEGG IDvpk:M636_14820
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-20, Aligned region: 43..134
Protein Sequence: 154 a.a.     [Download]
>gi|525958493|ref|YP_008316313.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MKPSSSHSSLAAFFVGPNMEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHSGNAMIDS
EYGLPDFNDVLSNNTNLVRHIQKNITATIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPM
SIDVYMGTDGQFNV
 
Nucleotide Sequence: 465 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1394822-1394358 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
TTGAAACCATCAAGCAGCCATTCTTCACTGGCTGCTTTTTTCGTAGGACCGAACATGGAAAAAGGTTATC
GTCTTTTAGAGCGGATTGAACTGGGTGAGCCCAAAAACTGCTACGAGAAAGTGGTCTCCCACAAGCACTT
GATTGAATCTATTCATTTGCATCTTGCAGATTTGCTGAATACGCATTCTGGTAATGCGATGATCGATAGT
GAATACGGTTTGCCCGATTTTAATGACGTTCTGTCTAATAATACGAATCTCGTTCGCCACATCCAAAAGA
ACATCACAGCGACCATAGAGCGCTTTGAACCTCGGCTACTTAACGTCGAAGTTCACTATCGTGAAGACCA
CCACAATCCATTACAGCTCGGTTTTGGTATTCGCGGAGAAGTTTCCCATAACGGCGGTAAAGTTCCAATG
TCGATCGATGTCTACATGGGAACCGACGGCCAATTCAACGTTTAG
 Primer design