SecReT6
Protein ID: 525958494
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14825
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1394830..1396305 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDS5JN64
KEGG IDvpk:M636_14825
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-187, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|525958494|ref|YP_008316314.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYNMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYTKWRGLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEHVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGSVHDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1396305-1394830 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGTCTGCAGAAGCACAAGCTCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTTAACGAAACTCGTTTAAAGCCAAGTGATGAAGGTTTTGATGTTGCTAAACGTGGCGTAGAAGCATT
CATTAGTGAGCTACTGAGCAGCTCGAATACAGAGAAAGTAGACCAATCTTTGGTTGACTTAATGATCTCT
GAAATCGACCAAAAACTGTCTAAGCAAGTTGATGCGATTCTTCACAACGAAGAAGTTCAAGCGATTGAGT
CAACTTGGCGTGGCCTGAAGTATCTTGTTGATCACACTGATTTCCGTGAGAACATTCAAATCGAACTAAT
TTCAGCGAAGAAAGACGAAGTTCTTGATGATTTTGAAGATGCACCGGAAGTGGTTAAGTCTGGCCTTTAC
AAGCAGATCTACACTCGCGAATACGGCCAATTCGGTGGTAAACCTGTAGGTGCGGTAATCTGTGACTACA
ACATGTCAGCGTCTTCTCCAGACATTAAGCTGATGGAATACATGGCAAATGTGGGCGCGATGTCTCATGC
ACCTTTCATAACGTCAGCATCGGCTAAGTTCTTTGGTCTGGATAGCTACGAAGAGCTACCAAACCTAAAA
GATTTGAAGTCTGTTTTCGAAGGTCCACAATACACGAAATGGCGTGGCTTACGTGAACACGAAGATGCTC
GTTACCTAGGTCTATGTACGTCTCGCTTTATGTTACGTACACCTTACTCTGTCGAAGATAACCCAATTAA
GGCGTTTGACTACGACGAGCACGTAACAGATAGCCATGATAACTACCTATGGGGTAACTCTGCGTACGCG
ATGGCTTCTAAGATCAGTGAGTCATTTGCTAAGTACCGTTGGTGTCCAAATATCATTGGTCCTCAAAGTG
GCGGTTCGGTTCATGACTTGCCAGTTTATAACTTTGAAGCAATGGGCCAAATTGAAACGAAGATCCCAAC
AGAAATCTTGGTATCTGACCGTCGTGAATACGAGCTAGCCGAAGAGGGCTTTATCGCTCTAACGATGCGC
AAAGGTTCTGACAACGCGGCGTTCTTCTCTGCAAACTCTGTTCAAAAACCAAAAGTGTTTGCAAACACTC
CAGAAGGCAAACAAGCAGAGATGAACTACAAGCTGGGTACTCAGCTTCCTTACATGTTCATTATCAACCG
TCTAGCGCACTACATCAAAGTGCTACAACGTGAGCAAATCGGTTCATGGAAAGAGCGTTCTGACCTAGAA
ATCGAATTGAACAAGTGGATCCGTCAATACGTTTCTGACCAAGAGAACCCACCAGCAGAAGTTCGTGGTC
GTCGTCCACTGCGTGCTGCTAAGGTTGAGGTATCAGACGTAGAAGGCGATCCAGGCTGGTACAAAGTATC
AATGTCTGTACGTCCTCACTTCAAGTACATGGGCGCAAGTTTCGACTTGTCTCTAGTTGGTAAACTAGAC
CAATAA
 Primer design