SecReT6
Protein ID: 525958495
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14830
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1396314..1396820 [-]
Producthypothetical protein
NoteTssB
UniProt IDS5J7I6
KEGG IDvpk:M636_14830
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|525958495|ref|YP_008316315.1| hypothetical protein M636_14830 [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNDVLEGMS
PNVRVNVENRLSDEEGAQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEEARKKLLDELSIGNDQDAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1396820-1396314 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGTGATA
CGCAAGAAGACGTTGAGCTGCCGCTGAGCATGATGGTGGTTGGTGACTTTACTGCACGTGCAGATGAGAC
GCCAATCGAAGAACGTACCCCAATTAACATCGATAAAGACAACTTTAATGACGTGTTAGAAGGCATGTCT
CCAAACGTTAGAGTAAATGTTGAAAACCGCTTATCTGATGAAGAAGGCGCACAGATCGGTGTTGACCTAA
CGTTCCAAAATATGAAGGACTTCTCTCCGGAAGCGATCGCGAAAAGTGTACCTGAACTTAACAGTCTTCT
TGAGCTTCGCGAAGCATTGGTTGCACTAAAAGGTCCTCTAGGTAACGTACCTGCGTTCCGTAAGAAGATT
GCATCGGTTCTTCAAGACGAAGAAGCAAGAAAGAAACTGTTGGATGAACTAAGCATTGGCAACGACCAAG
ACGCGAAAGAAGAGTAA
 Primer design