SecReT6
Protein ID: 525958496
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14835
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1396847..1398421 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDS5JSX9
KEGG IDvpk:M636_14835
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.90E-18, Aligned region: 48..108
Protein Sequence: 524 a.a.     [Download]
>gi|525958496|ref|YP_008316316.1| type VI secretion protein [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MSVIEIERLLAPISDVNPVGEDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHAIEVLEHHSKDLKAI
CYLVRALTEEFGLQGFEQGLKLLSEALNRFGVELYPSRKRGRDGAVEWLNHQFKLVSSRFAESAQSWDLV
SGCISIIEEVQRQYDDIYQDSEADFFEIRSQLNVLSQQATVDDQSDGAMATIEQTAPLTASQPVAVETPA
QSEVQTVVEKALPSAPKPAPVKKTVTKEVDVDTDFSSPTASKRTLKKVAEVMIHANPSEPLAYRIYRHLT
WDDIDGLPDHQSNETPLSLAVSSDQQAEYRDKASQESDIDTVKRLERTLTDAPFWLTGHYFVYSMLNNLG
FNDAALAVKQEVKRFVDSLEGIELLTFKNSIPFADEATLSWLSTQAATSSSAQSVVQTIVITDEDSLPME
DITLANLGEYAAELAHKLELDFSGRGQFMLHLQLIAAYQSVGLYPLCLPYLEKAWEVQQAFNLASWEPHL
SSQLEDLIRKTLHQLFRNKDLLPEKYEKWKAIYD
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1398421-1396847 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGTCTGTGATCGAAATTGAACGTTTACTTGCGCCTATCTCTGACGTAAATCCTGTCGGTGAAGATGCTC
GTTACGAATTTTGTTATGAAATGATGGAATCCGAAGTGAAGAAGTTCGGATCCTTGTTTGGCGAAACGGT
AGATTGGAGTGTCGTAAAAACGCACGCCATTGAAGTTCTTGAACACCACAGCAAAGATTTAAAAGCAATT
TGTTACCTTGTTCGCGCGCTTACAGAAGAATTTGGTCTGCAAGGTTTCGAGCAAGGTCTAAAGCTGCTTA
GTGAAGCGTTAAATCGTTTTGGCGTTGAGCTGTACCCGTCGCGAAAACGGGGTAGAGATGGTGCGGTAGA
GTGGTTGAACCATCAGTTTAAATTGGTGAGCAGCAGGTTTGCAGAAAGCGCCCAATCATGGGATTTGGTT
TCAGGTTGTATTTCGATTATCGAAGAAGTCCAACGTCAGTACGACGATATTTACCAAGACTCCGAAGCGG
ACTTCTTTGAAATTCGTAGTCAACTCAATGTGCTATCTCAACAAGCGACTGTCGATGACCAAAGCGATGG
TGCAATGGCTACCATCGAACAAACAGCTCCGCTAACGGCTTCACAGCCTGTAGCAGTAGAAACTCCGGCA
CAAAGTGAAGTTCAAACCGTTGTAGAAAAAGCGCTTCCGTCGGCTCCTAAACCTGCACCAGTTAAGAAAA
CAGTAACAAAAGAAGTCGATGTCGATACGGATTTTTCATCGCCGACCGCTTCTAAACGTACACTTAAGAA
AGTTGCGGAAGTTATGATTCATGCGAATCCAAGTGAGCCGCTAGCTTACCGAATTTATCGTCACCTAACT
TGGGATGATATTGATGGTCTTCCTGATCATCAAAGCAATGAAACGCCATTGAGTTTGGCTGTGTCGTCTG
ATCAGCAGGCTGAGTACCGCGATAAAGCCTCTCAAGAAAGCGACATTGATACAGTTAAGCGTTTGGAGCG
CACGTTAACCGATGCTCCGTTTTGGCTGACGGGTCACTACTTTGTTTATTCGATGTTAAACAACCTAGGC
TTTAATGACGCAGCGCTCGCTGTGAAGCAAGAAGTGAAGCGTTTTGTTGATTCATTAGAGGGCATTGAAC
TCCTCACATTTAAGAATTCTATACCATTTGCAGATGAAGCAACGTTGAGCTGGTTATCGACTCAAGCTGC
AACTTCTTCAAGTGCTCAATCTGTCGTTCAAACGATTGTCATCACAGATGAAGACTCACTGCCAATGGAA
GATATCACCCTAGCCAACTTAGGGGAGTATGCCGCAGAACTCGCACACAAACTCGAACTGGATTTCTCGG
GACGTGGGCAGTTTATGCTGCATTTACAATTGATAGCAGCTTACCAGTCTGTTGGATTATACCCGTTGTG
TTTGCCTTACCTTGAAAAAGCTTGGGAAGTGCAACAAGCGTTTAATCTCGCGAGCTGGGAACCCCACTTA
TCGTCACAGCTAGAAGACCTGATTCGAAAAACACTGCATCAGTTATTCAGAAACAAGGATCTTTTGCCTG
AGAAGTACGAAAAGTGGAAAGCAATTTATGACTAA
 Primer design