SecReT6
Protein ID: 525958501
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14865
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1404451..1406529 [-]
Producttype VI secretion protein VgrG
NoteTssI
UniProt IDS5JSY7
KEGG IDvpk:M636_14865
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-69, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 5.40E-69, Aligned region: 501..536
Phage_base_V [PF04717], Evalue: 9.00E-23, Aligned region: 312..332
Phage_base_V [PF04717], Evalue: 9.00E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 534..543
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 568..591
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 616..636
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 673..691
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|525958501|ref|YP_008316322.1| type VI secretion protein VgrG [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MVNDVEFKFEVPGCGHEFRVESFQVNEELSKPFHISLSLLSLDPDISFDSLIRKAGTLTLYGQGLSAARI
FNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAKDIITEVLDDGSVTDYRFELSGIYP
PKEYALQYRESDLHFVQRMMAEHGMWYYFDHTDSNHTMVIVDSNDAIAPLVSSPLNASYIGPIVYHADSG
GVADREHISDLELVNRVRTGQVTYTDYNYEQPKIPQEMTHAGDLDQDLKQFDYPGRYVDPVMGQVRTTEW
MSEHIVDNQQVEASSDVMRLASGYSFNISDHPRSEINRDYIMLSVMHTGQDPQVHEDEASGMPTTYYNQF
TCIPRDVVFKAPRLAAPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWDRYGNNDEHASCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIDGHKTTQVNSTFTETVEQ
DVTVTYNANETQYVKNNSDLEIGDNRTTKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSV
KGNTSYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGSDKVVVKGGNVAIN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1406529-1404451 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCAGGGTGTGGGCACGAGTTTCGAGTAGAAAGCTTTC
AAGTAAATGAAGAGCTTTCGAAACCTTTTCACATCAGTCTCTCATTACTTTCACTTGATCCAGATATCTC
TTTTGATTCGTTAATACGAAAAGCAGGTACACTGACTCTTTATGGACAAGGCTTAAGCGCGGCACGCATA
TTCAATGGTGTGGTGAACGAAGTTCGTTATTTGGGTACAGGCCGTCGCTTCTCTCGCTATCAGTTAGTTT
TGGTTCCGCAAGCTTGGTTCTTATCACAACGTCAAGACTGTCGTATTTTCCAACAAAAATCAGCGAAAGA
TATAATTACAGAGGTGCTTGATGATGGTTCAGTGACCGACTATCGTTTTGAATTATCTGGTATTTATCCA
CCAAAAGAGTACGCGCTGCAATACCGTGAGTCAGACCTACACTTTGTTCAGCGTATGATGGCAGAACACG
GTATGTGGTACTATTTCGACCACACCGATTCAAACCACACAATGGTCATTGTCGATAGTAACGATGCCAT
TGCTCCACTGGTTAGCTCTCCTCTCAATGCATCTTATATTGGGCCGATTGTATATCACGCCGATAGTGGG
GGTGTTGCTGATCGTGAGCATATCTCCGATCTCGAGTTAGTTAACCGTGTGAGAACGGGTCAGGTTACTT
ACACTGACTACAATTACGAGCAGCCAAAGATCCCGCAAGAGATGACTCACGCAGGCGATCTGGACCAAGA
TTTAAAGCAGTTTGATTATCCTGGACGTTATGTTGACCCTGTAATGGGGCAGGTGAGAACCACTGAGTGG
ATGTCTGAGCACATTGTCGATAATCAGCAAGTAGAAGCGAGCAGTGATGTGATGCGTTTGGCGTCTGGTT
ACAGTTTTAACATCAGTGACCATCCTCGCTCTGAAATCAACCGTGATTACATCATGTTATCCGTCATGCA
CACAGGGCAAGACCCACAAGTGCACGAAGACGAAGCGAGTGGCATGCCAACTACTTACTACAACCAGTTC
ACGTGTATTCCACGTGATGTTGTATTCAAAGCGCCCAGGTTGGCGGCTCCAGTAGTGGATGGTCCGCAAA
CTGCGGTTGTAGTTGGTCCTGCAGGGGAGGAGATCTACACCGATAAACTAGGACGAATTAAGGTTCAGTT
CCATTGGGATCGCTATGGTAACAACGATGAACATGCAAGTTGCTGGATTCGTGTGAGTCAATCAATGGCT
GCTCCAACGTGGGGCGCGGTTTACTTGCCACGTATTGGCCATGAAGTCGTAGTGACCTTCCTTGAAGGCG
ACCCAGATCGCCCATTGGTGACTGGCGCAGTTTATAATGGTCTTCACTTCCCTCCGTACTCGTTGCCTGA
GAACAAAACTCGTACTACGTTCCGTACGCAAACGCACAAAGGCACCGGCTACAACGAACTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTACATTCATGCTCAAAAAGATATGTCGACCAAAGTTCTCAACAATC
GTTACCGAGATATCGGTCAGGATGAGTTCTTAAAGGTTGCGCGTCATCAGACGAACGAAGTCCATGGTGA
TCATAAAGAAACCATTGATGGCCACAAAACAACCCAAGTAAACAGCACTTTTACCGAGACAGTAGAGCAA
GACGTTACCGTTACATACAACGCCAACGAAACCCAATATGTGAAGAACAATTCTGATTTGGAAATTGGTG
ATAACCGCACAACCAAGATCGGCAAGAACGATGATTTGGATGTGGGTGAAAACAGCAACTTAACTGTTGG
TGCATCAAAAAGCTCGGACATTGGTGCCGATGATAACCAAACAGTGGGTGGCAACTTAACCGTATCGGTA
AAAGGCAATACATCTTACAAAGCCGATGGCGCGACACAGATCATCAGTGGTGACAAGATTGTACTGAAAA
CAGGCGGTTCTTCTTTAGTGATGAACAGTGATGGTTCAATCAAGCTCTCAGGGTCTTCAATCACCATTGA
AGGCAGTGATAAAGTCGTCGTGAAAGGTGGTAACGTAGCGATTAACTAA
 Primer design