SecReT6
Protein ID: 525958503
SecReT6 ID827
T6SS typei1
Gene symbol-
Locus tagM636_14875
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1407569..1410247 [+]
ProductATPase AAA
NoteTssH
UniProt IDS5JDJ2
KEGG IDvpk:M636_14875
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.10E-45, Aligned region: 221..271
AAA_2 [PF07724], Evalue: 7.10E-45, Aligned region: 626..790
AAA [PF00004], Evalue: 1.70E-22, Aligned region: 222..350
AAA [PF00004], Evalue: 1.70E-22, Aligned region: 631..755
AAA_16 [PF13191], Evalue: 7.70E-15, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 7.70E-15, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 7.70E-15, Aligned region: 406..505
AAA_16 [PF13191], Evalue: 7.70E-15, Aligned region: 602..653
AAA_16 [PF13191], Evalue: 7.70E-15, Aligned region: 695..724
AAA_16 [PF13191], Evalue: 7.70E-15, Aligned region: 851..868
ClpB_D2-small [PF10431], Evalue: 1.60E-14, Aligned region: 460..493
ClpB_D2-small [PF10431], Evalue: 1.60E-14, Aligned region: 797..872
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 222..240
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 294..350
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 630..788
AAA_22 [PF13401], Evalue: 9.20E-10, Aligned region: 220..316
AAA_22 [PF13401], Evalue: 9.20E-10, Aligned region: 628..743
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 220..278
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 435..470
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 630..751
AAA_17 [PF13207], Evalue: 4.30E-06, Aligned region: 222..285
AAA_17 [PF13207], Evalue: 4.30E-06, Aligned region: 469..469
AAA_17 [PF13207], Evalue: 4.30E-06, Aligned region: 629..653
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 220..247
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 274..315
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 626..662
IstB_IS21 [PF01695], Evalue: 4.70E-05, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 4.70E-05, Aligned region: 630..650
IstB_IS21 [PF01695], Evalue: 4.70E-05, Aligned region: 740..760
Zeta_toxin [PF06414], Evalue: 7.90E-05, Aligned region: 142..212
Zeta_toxin [PF06414], Evalue: 7.90E-05, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 7.90E-05, Aligned region: 300..342
Zeta_toxin [PF06414], Evalue: 7.90E-05, Aligned region: 629..670
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 222..247
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 279..320
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 630..655
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 627..652
AAA_18 [PF13238], Evalue: 0.00018, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.00018, Aligned region: 497..552
AAA_18 [PF13238], Evalue: 0.00018, Aligned region: 631..659
Arch_ATPase [PF01637], Evalue: 0.00068, Aligned region: 200..233
Arch_ATPase [PF01637], Evalue: 0.00068, Aligned region: 272..305
Arch_ATPase [PF01637], Evalue: 0.00068, Aligned region: 629..651
RuvB_N [PF05496], Evalue: 0.00072, Aligned region: 220..237
RuvB_N [PF05496], Evalue: 0.00072, Aligned region: 275..300
RuvB_N [PF05496], Evalue: 0.00072, Aligned region: 582..652
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 222..241
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 631..652
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 732..749
DUF258 [PF03193], Evalue: 0.0034, Aligned region: 190..238
DUF258 [PF03193], Evalue: 0.0034, Aligned region: 629..651
Protein Sequence: 892 a.a.     [Download]
>gi|525958503|ref|YP_008316324.1| ATPase AAA [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MAMININLSSLIQRLHPIAKVALEDAAALAVSEKANEVQIEHYLLSLLERPNSDFDVLLSHFDCSENLLR
QSVRSTLDTNAKGNGSKPVFSALLIEWLQESWLVSSLDLSETQIRSGALLLTLVSNPLRYGQHGYASILE
AVNPDSLKRNFAELTSYSIEAQVATSEKTQAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIVDI
LARRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGVELYGLDMGLLQAGASVKGEFEKRLNAVL
DEVKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRF
QLVKLDEPSPEQAALIIRGLRPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACARVNI
SLNAIPASVETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLKLAMETTKEELAEQEVQWHKEKEQ
IQEMIALRSRLHELVFGKVNEEELVVDEDSEQDVSPYTEMDEEAVRIAISACQEQLDAIRNGNSLVHFEV
GPDEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEYAIDALSEGIQTAKAGLGNPDAPTGVF
LLVGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPY
SVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKDIDANIIA
EAIRPTLNQHFKPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLQSHHKLSLSYEESLVDFVLGNCR
LAETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQITVSVDEQGTLIYAFS
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|525957490|ref|NC_021848.1|:1407569-1410247 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGGCTATGATAAATATAAACCTTTCTTCATTAATTCAGCGTCTACACCCGATAGCTAAAGTAGCATTAG
AAGATGCCGCAGCACTCGCAGTCTCGGAAAAAGCAAACGAAGTTCAAATTGAGCATTATTTACTGAGTCT
ATTAGAAAGGCCAAATAGTGATTTTGACGTCTTATTAAGTCATTTTGATTGTTCTGAGAACTTATTGAGA
CAATCGGTTCGATCCACACTCGATACCAACGCCAAAGGAAATGGCAGCAAACCTGTTTTTTCTGCTTTAT
TAATCGAATGGTTACAAGAAAGTTGGCTGGTTTCTTCTTTAGATCTATCCGAAACACAAATCCGCTCTGG
CGCCCTACTCCTTACTCTTGTTAGCAACCCTCTGCGTTATGGTCAACATGGTTACGCGTCTATCCTTGAA
GCAGTAAACCCTGATAGCCTTAAACGTAACTTTGCAGAACTAACAAGCTACTCTATTGAGGCGCAAGTCG
CAACTTCAGAGAAAACTCAAGCACGCGAAGATGGTTCAGCACTGAGCAAGTTCACGACAGACTTCACTGG
TAAAGCACGCAAAGGCGAAATCGATCCTGTTTTCTGCCGTGACCAAGAAATCCGCCAAATTGTAGACATT
CTTGCTCGTCGCCGTAAAAACAACCCTATTGCTGTTGGTGAACCGGGCGTTGGTAAAACCGCAGTTGTTG
AAGGCTTGGCGCTTAAGATCGTGCAAGGAGACGTACCAGACAATCTAAAAGGCGTAGAGCTTTACGGCCT
AGATATGGGTCTTCTGCAAGCTGGCGCTAGCGTAAAAGGTGAATTTGAAAAACGCCTAAATGCAGTATTG
GATGAAGTGAAAAACTCGCCAACACCGATCATCTTATTCATCGATGAAGCGCACACCCTTGTTGGCGGCG
GCAACCAAGCGGGCGGTAGCGATGCTGCTAACTTATTAAAACCTGCCTTAGCACGTGGTGAAGTAAAGAC
AATCGCAGCAACAACATGGTCGGAGTACAAAAAGTACTTTGAGAAAGATCCAGCGCTTGCGCGTCGTTTC
CAACTGGTGAAACTCGACGAACCGTCTCCTGAACAAGCAGCATTGATCATTCGTGGTCTGCGCCCGGCGT
ACGAGAAATCTCACAATGTTTACGTACGTGACGACGCTATCACCGCAGCGGCAGCGCTTTCTGCGCGTTA
TATCTCTGGCCGTCAACTACCGGACAAAGCGATCGATGTACTAGATACGGCATGTGCACGAGTGAACATC
AGCCTTAATGCCATTCCTGCTTCTGTTGAGACTCTTCAGCAAGAACTTGCAGCTCAACAGCGCGAGCTTG
AAGCGCTTGAGCGTGATGCTCTGCAGCAAACTGGCGACAAGCACAGCCTTGCTAACATTCCAGACCTAAA
ATTGGCAATGGAAACGACAAAAGAAGAGCTAGCAGAACAAGAAGTGCAATGGCACAAAGAAAAAGAGCAG
ATCCAAGAGATGATTGCTCTACGCTCTCGCTTACATGAACTGGTCTTTGGCAAAGTAAATGAAGAAGAGC
TTGTTGTAGACGAAGATTCAGAACAAGACGTTTCTCCATATACAGAAATGGATGAAGAAGCAGTCCGCAT
TGCGATTTCAGCATGCCAAGAACAGTTAGACGCAATCCGCAATGGCAACTCATTAGTTCACTTTGAAGTT
GGGCCAGATGAAGTCAGCCACGTTATCTCAGACTGGACTGGCATTCCAATGGGTAAGATGCTTCAAGACG
AAGCAGAAACCACGCTAAAACTGAAAGAAAGCCTAACACAAAGCATCAAAGGCCAAGAATACGCTATCGA
TGCACTGTCTGAAGGCATTCAAACCGCAAAAGCTGGCTTGGGTAATCCAGACGCACCGACAGGCGTATTC
CTGCTAGTTGGCCCAAGTGGCGTGGGTAAAACCGAAACTGCTCGTGCGATCGCTGATCAAATGTTTGGTG
GTGAGCGCTTTATGACGACCATTAACATGTCTGAGTTCCAAGAGAAGCACACGGTATCTCGCCTAATCGG
TTCGCCTCCTGGTTACGTAGGTTACGGTGAAGGCGGCATGCTGACAGAAGCGGTACGTCAGCGTCCATAT
TCTGTTGTACTTCTTGATGAAGTAGAAAAAGCCGATCCAGAAGTGTTGAACCTGTTCTACCAAGTGTTCG
ACAAAGGTACGCTGAACGACGGCGAAGGCCGCACCATCGACTTCAAGAATACGCTGATCATCATGACCAG
TAACCTTGCAACGCACGAGATTGAATCTTTGGTTCATCAATCCAAAGACATCGATGCAAACATCATCGCA
GAAGCTATCCGCCCTACTTTGAACCAACACTTCAAACCAGCGCTGTTGGCGCGTATGTCTGTGCTTCCGT
TTGTTCCGCTATCTGATGAAGCAATGACAGAAATCATTCACCATAAGCTGAACAAAGTTTCTCAGCGTCT
ACAGAGCCATCACAAGTTGTCTCTGAGCTACGAAGAAAGCTTGGTCGATTTCGTACTAGGTAACTGTCGC
CTTGCTGAAACAGGCGCACGTAACATTGACGCGGTCATCAACCGTCAGTTACTGCCTCAGCTATCGACAC
AGCTATTGGTGCATGATAAGGATGATTCACACACGCAAATCACAGTTTCTGTCGATGAGCAAGGAACACT
GATCTATGCGTTCAGCTAA
 Primer design