SecReT6
Protein ID: 526227377
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1424
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1415188..1416111 [-]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDS5N7R5
KEGG IDsbz:A464_1424
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.30E-17, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 9.30E-17, Aligned region: 184..199
Protein Sequence: 307 a.a.     [Download]
>gi|526227377|ref|YP_008322020.1| Uncharacterized protein ImpA [Salmonella bongori N268-08]
MEAIETLLTPVSPEHPCGESVRYSPEFDRLAAARQQDDETLPTGVWQSTPRRADWEEVARLACELTLSRS
KDLVIMSWLGEAWLHLRGLVALPDALSLLALALERYPNELHPQIKDDDYDYRAAPLCWVAQHYAAMVANA
PLFTCEEETISLAQWQQGKRHDLPPPEMQANIGLALTASLKWLQRLTDLCQNWPDATAPSFNVLEQKIKT
CQQALGHSVTERPQSEAGETQISAATNSPAFASREEAYQMLKQIADYLQRTEPHSPVPYLLHRACIWGHT
PLPELLNELLVSDEAARQLWRQLGVLP
 
Nucleotide Sequence: 924 bp     [Download]
>gi|526225953|ref|NC_021870.1|:c1416111-1415188 Salmonella bongori N268-08, complete genome
ATGGAAGCTATAGAGACGCTACTGACGCCTGTCAGCCCGGAGCATCCTTGTGGAGAATCGGTACGCTACT
CGCCGGAATTCGACCGGCTGGCGGCGGCGCGGCAACAGGATGATGAAACTCTGCCGACCGGCGTCTGGCA
AAGCACGCCGCGACGCGCCGATTGGGAAGAGGTCGCCCGGCTGGCCTGCGAGTTAACGCTATCGCGCAGT
AAAGATCTGGTGATTATGAGCTGGCTGGGGGAAGCCTGGTTACACCTGCGCGGTCTGGTGGCGCTGCCCG
ACGCGCTGTCCCTGCTGGCGCTGGCGCTGGAGCGCTACCCGAACGAGCTACATCCACAAATTAAGGATGA
CGATTACGATTATCGCGCTGCCCCACTCTGCTGGGTAGCGCAGCATTATGCCGCGATGGTTGCTAACGCG
CCGCTGTTTACCTGCGAGGAGGAAACCATCTCGCTGGCGCAATGGCAACAGGGAAAACGCCACGATCTCC
CTCCCCCTGAAATGCAGGCCAATATTGGTCTGGCCCTAACGGCGAGCCTGAAGTGGCTGCAGCGCCTTAC
CGATCTTTGCCAGAACTGGCCTGACGCAACCGCCCCCTCTTTCAATGTGCTGGAGCAGAAAATTAAAACC
TGTCAACAGGCGCTGGGACATAGCGTCACTGAACGTCCACAGTCGGAAGCCGGAGAAACGCAAATATCTG
CGGCGACGAACTCGCCGGCATTCGCCAGCCGTGAAGAGGCCTACCAGATGCTTAAACAGATTGCGGACTA
CCTGCAGCGTACGGAACCCCATAGTCCGGTGCCTTATCTGCTACATCGCGCCTGTATATGGGGACATACG
CCGTTACCAGAGTTACTTAACGAATTGCTCGTCAGCGATGAAGCCGCCCGCCAGCTCTGGCGGCAACTGG
GGGTGTTACCATGA
 Primer design