SecReT6
Protein ID: 526227378
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1425
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1416125..1419664 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDS5MPH4
KEGG IDsbz:A464_1425
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.30E-23, Aligned region: 111..283
ImcF-related_N [PF14331], Evalue: 6.30E-23, Aligned region: 290..332
Protein Sequence: 1179 a.a.     [Download]
>gi|526227378|ref|YP_008322021.1| IcmF-related protein [Salmonella bongori N268-08]
MTQPWLTLLIIVLVLLVVTLWCLWWQWEYRNNTFIRAQKEIQHACGGQDPYDSNRILMLGDEADNRLLCR
SWSLADGAEYWFGQWWYNQQCSLLCVPQTLQMPGKKRLIRQSDWQKLLAALVKSRPQRPLDAMIITLPLD
ALRGDDNKQAQLLNNCHQIQQACGLSLPVYLIVSGLEEIEGTQDLLTLLSDEAKRSPIGSAIPVAREAIW
KSVWIDDALANTRHTLRDVITALGTLHGHTSGTLFRLPEFFLTIATPLHDYFDTLLNSSARDEPPLLRGI
WFVARSAIADKPHMQFCQNLLEGKIIAESGLALPVRRLLRLNLRRHFITLACYSCAGILWLVAMIWSWHY
QHTNALVLHDRLQLLATQTARDSNSGERTATLYWRILNAVPQWQFRSIVWPGSLFSRTDNKLRETFQNAT
LASLLAPAANSVCLQDQTPRAGELSGEHDDLLPDERYRNITQLLAQTKQMEAHYLPLLQLMQVKQPTVQT
LAAISASVWGVNVDTDSLPSRTALNELFATLNINRLRLPEISDLTQRNSELFSRETMRWLEQHYGNTSLD
NNEEQLEQILTLFSNGTAVTPFFVRSLVRQISRLQSALATINNLSRDAAHSPIRLPLDDLLAQAHSLRLI
DNKVGQALLRHEALLRQRFLAQVDGSRLHFSSLTEQSPEGEFSVSPDILALQKSLRDLLNQPFWQRGTNQ
TQPNKSGYPGELQLQQALMLYNGYQRFIQQLPDSLWRPKLLSLAQNAVENAMLQALYADAPEAVQENNID
TLSAGQAIDALVQLNRPQRAVALRQQIAVQIIARIRREGSALLPANAPPAVNYMTPEQAQDSSQRMTSWA
NAQTEQISATLARYQQDIAWLDRQRPWLNSEDNQLIMRWTNSLGAMQRLQQQDPTSPPARMTALAAMIPT
LNAQNCQSELTPFTASGSNDFYSQSLNSLINASQQKCQQLRQHESAGTVQAISNLYNVWLAGHFPFTTLP
HAPDADIDRVRELTQLLATLPADSLAIQPPLIQQLAAAQPLLAALLSPDGVVVRVHWRTQRDKEAGADQI
VDWRLSGNQQSISYPGGTREDLHWRSGDNLSFSLRWATNSAWRPLPGSPQSVTVVDDTGRWRWQGAWSLL
RMISQQRPGGELALPLSLRFSLPTGNGQQRAQATVYFNVALLDAEGKAPLAWVPLSAKE
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|526225953|ref|NC_021870.1|:c1419664-1416125 Salmonella bongori N268-08, complete genome
GTGACGCAACCCTGGCTTACGCTTCTTATTATTGTGTTGGTGCTGTTGGTGGTGACCCTCTGGTGCCTCT
GGTGGCAATGGGAATACCGCAATAACACGTTTATCCGCGCACAAAAAGAGATCCAGCACGCCTGTGGCGG
CCAGGATCCCTACGATAGTAACCGGATCCTGATGCTGGGCGACGAGGCGGATAACCGCCTGCTGTGCCGC
AGCTGGTCGCTCGCCGATGGCGCAGAATACTGGTTCGGGCAGTGGTGGTATAACCAGCAGTGTTCACTGC
TTTGTGTGCCGCAAACTCTGCAAATGCCGGGCAAAAAGCGGCTCATCAGACAAAGCGACTGGCAAAAACT
GCTGGCGGCGCTGGTAAAAAGCCGCCCCCAGCGTCCTCTGGATGCGATGATTATCACTCTACCGCTTGAC
GCGTTGCGCGGTGATGACAATAAGCAGGCGCAACTGCTGAATAACTGCCATCAAATCCAGCAGGCATGTG
GCTTGAGCCTGCCAGTCTATCTGATAGTAAGCGGTCTGGAAGAGATCGAAGGCACTCAGGATTTACTGAC
GCTTTTGTCTGATGAGGCCAAACGTAGCCCGATAGGCAGCGCAATTCCGGTCGCCCGGGAGGCTATCTGG
AAGTCAGTATGGATTGACGACGCGCTGGCCAACACGCGCCATACCCTGCGCGATGTTATTACAGCGCTGG
GCACATTGCATGGACACACGTCAGGCACGCTTTTCAGACTGCCGGAGTTTTTCCTCACTATCGCCACCCC
CCTGCATGATTATTTTGATACCTTGCTCAATAGCAGCGCCAGGGACGAACCGCCGTTGCTACGCGGCATC
TGGTTTGTCGCCCGCAGCGCTATCGCCGATAAACCACACATGCAGTTTTGCCAGAATTTACTGGAGGGAA
AAATCATTGCCGAAAGCGGGCTGGCGCTCCCGGTTCGCCGTCTGCTGCGACTTAATCTGCGGCGCCATTT
TATTACGCTTGCCTGCTATAGTTGCGCGGGTATTCTCTGGCTGGTGGCGATGATCTGGAGCTGGCATTAC
CAGCATACCAATGCCCTGGTGCTACACGATCGCCTGCAATTACTCGCCACTCAAACCGCTCGCGACAGCA
ACTCTGGCGAACGTACCGCTACGCTCTACTGGCGTATTCTGAACGCGGTGCCACAGTGGCAGTTCCGCTC
CATCGTCTGGCCCGGCTCGCTGTTCAGCCGTACCGATAATAAACTGCGTGAAACATTCCAGAATGCAACG
CTGGCAAGCCTGTTGGCCCCTGCCGCCAATAGCGTCTGTCTGCAGGATCAAACTCCCCGCGCCGGCGAAC
TTTCGGGCGAGCATGACGATCTACTGCCTGATGAACGTTACCGGAACATCACCCAGCTTCTCGCCCAGAC
CAAACAGATGGAGGCCCATTACCTGCCCTTGCTCCAGCTTATGCAGGTAAAACAACCCACTGTCCAGACT
TTAGCGGCCATCTCCGCCAGCGTCTGGGGGGTTAATGTCGATACCGACTCGTTACCCTCACGGACCGCGC
TAAATGAACTGTTTGCCACTCTCAATATCAACCGTCTGCGCCTGCCGGAAATCAGCGATCTGACGCAGCG
CAATAGCGAGCTCTTTTCCCGGGAGACGATGCGCTGGCTGGAACAGCACTATGGCAACACCAGTCTTGAC
AACAATGAGGAGCAACTGGAGCAGATACTGACGTTGTTCAGTAACGGTACGGCGGTAACGCCGTTTTTTG
TCCGCTCGCTGGTGCGCCAGATCAGCCGTTTACAAAGTGCGCTGGCAACAATTAATAATCTCAGCCGCGA
TGCGGCGCATTCCCCTATCCGCCTACCGCTGGACGATCTGCTGGCGCAGGCTCACTCCCTGAGGCTTATT
GATAATAAGGTCGGCCAGGCGTTGCTACGCCATGAGGCGTTACTGCGACAGCGTTTTCTGGCGCAGGTTG
ACGGCTCGCGACTGCATTTTTCTTCGCTGACCGAACAGTCGCCGGAAGGCGAATTCAGCGTATCTCCAGA
TATTCTTGCGCTGCAAAAAAGTTTACGCGACCTGCTTAACCAGCCCTTCTGGCAGCGTGGCACAAACCAG
ACGCAACCCAATAAATCCGGCTATCCGGGAGAATTACAGTTGCAGCAAGCATTAATGCTGTATAACGGCT
ACCAGCGTTTCATCCAGCAACTGCCGGACAGCCTGTGGCGGCCCAAATTACTGTCGCTGGCGCAGAATGC
GGTCGAAAATGCAATGTTACAGGCGCTCTATGCCGATGCGCCGGAAGCCGTGCAGGAGAACAACATCGAC
ACGTTAAGCGCGGGTCAGGCAATCGACGCCTTAGTTCAACTTAATCGCCCGCAGCGCGCAGTGGCGCTTC
GCCAGCAAATTGCGGTACAGATTATCGCCCGTATCCGCCGCGAGGGCAGCGCCCTATTGCCAGCCAACGC
GCCACCAGCCGTAAATTATATGACCCCGGAACAGGCACAGGATAGCAGTCAAAGGATGACAAGTTGGGCG
AATGCGCAGACGGAGCAAATTTCCGCCACGCTTGCCCGTTACCAGCAGGATATCGCGTGGCTTGACCGGC
AGCGGCCATGGCTTAACAGCGAAGACAACCAGCTTATTATGCGCTGGACAAACTCGCTTGGCGCGATGCA
ACGTCTGCAACAACAAGACCCGACCAGTCCGCCCGCGCGAATGACGGCGCTTGCCGCCATGATACCGACG
CTGAATGCGCAGAATTGTCAGAGCGAACTGACGCCGTTTACCGCCTCCGGCAGCAACGATTTTTACAGCC
AGTCGCTGAATTCGCTAATCAACGCCTCACAGCAAAAATGCCAGCAGTTACGCCAGCACGAGAGCGCCGG
TACGGTACAAGCCATTAGTAACCTCTATAACGTCTGGCTGGCAGGCCATTTTCCGTTTACCACCTTACCT
CACGCGCCAGACGCCGATATTGATCGAGTGCGCGAACTCACGCAACTTCTCGCCACGCTGCCCGCGGACT
CCCTCGCCATTCAGCCGCCACTGATCCAGCAGTTGGCGGCTGCGCAGCCGCTGCTCGCCGCGCTGCTCTC
CCCCGACGGCGTAGTCGTGCGCGTCCACTGGCGCACCCAACGTGATAAAGAAGCAGGAGCGGATCAGATA
GTCGACTGGCGTCTTAGCGGCAATCAGCAGTCGATAAGCTACCCTGGCGGCACGAGGGAAGATCTGCACT
GGCGAAGCGGCGATAATCTGAGCTTCAGCCTGCGCTGGGCAACTAATTCCGCCTGGCGGCCTTTACCAGG
TTCGCCGCAAAGCGTGACGGTGGTGGATGATACCGGACGCTGGCGCTGGCAGGGCGCGTGGTCGCTGTTG
CGAATGATAAGCCAACAGCGTCCTGGTGGCGAGTTAGCATTGCCATTATCTCTGCGCTTCAGCCTGCCTA
CCGGTAACGGCCAGCAGCGGGCCCAGGCCACCGTTTATTTCAACGTCGCGTTACTGGACGCGGAAGGGAA
AGCGCCGCTGGCGTGGGTACCGCTTAGCGCAAAAGAATAA
 Primer design