SecReT6
Protein ID: 526227379
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1426
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1419661..1420407 [-]
ProductInner membrane protein DotU
NoteTssL
UniProt IDS5NEF4
KEGG IDsbz:A464_1426
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-24, Aligned region: 47..218
Protein Sequence: 248 a.a.     [Download]
>gi|526227379|ref|YP_008322022.1| Inner membrane protein DotU [Salmonella bongori N268-08]
MPVNPDMPACRLFDDIFSRWLTQFEQWKRITLPPEALHQLAFDYSNQTVADYSRRLTRELGTPFKQHIDA
AIYALVALLDETVLYSDWPALSWWQDCPLEYHLWQTHSAGDQFPAHIQALLNERNPAQRDLAALYLRCLT
LGFGVKRDNFDEQAHQETCRLLWHFAFQEEAQMSGIAQKLNADSLASPLQLPPRRRLPDNSRLHLIAFIV
LLALLLLSQRLWLSIEDAIGVSTLPNFPVTQYCEGDRS
 
Nucleotide Sequence: 747 bp     [Download]
>gi|526225953|ref|NC_021870.1|:c1420407-1419661 Salmonella bongori N268-08, complete genome
ATGCCTGTTAATCCAGATATGCCCGCCTGCCGGTTATTTGACGACATTTTTTCCCGCTGGCTGACCCAAT
TTGAGCAATGGAAGCGCATCACCCTGCCTCCTGAAGCGCTGCACCAGTTAGCTTTCGACTACAGTAATCA
GACTGTCGCCGATTATAGCCGACGCCTGACCCGTGAACTGGGCACGCCCTTTAAGCAGCATATTGATGCC
GCGATTTATGCGCTGGTAGCGCTGCTCGATGAAACCGTTCTTTATAGCGACTGGCCTGCACTTAGCTGGT
GGCAGGACTGCCCGCTGGAATACCATCTCTGGCAAACTCACAGCGCTGGCGACCAGTTTCCCGCTCATAT
TCAGGCACTGCTGAATGAACGCAACCCTGCGCAACGCGATCTGGCGGCCCTTTATCTGCGCTGCCTGACG
CTGGGCTTTGGTGTCAAACGTGACAACTTCGACGAACAAGCCCATCAGGAGACCTGCCGTTTGCTATGGC
ATTTTGCTTTTCAGGAAGAGGCGCAAATGTCGGGCATCGCGCAAAAGCTCAATGCCGACTCGCTGGCGTC
GCCTTTGCAGCTTCCTCCCCGCCGCCGCCTTCCGGACAATTCCCGTCTGCATCTGATCGCTTTCATTGTG
CTACTGGCGCTGTTGTTACTAAGCCAACGGCTGTGGCTGAGTATTGAAGATGCCATTGGCGTCAGCACTC
TGCCCAACTTTCCAGTGACGCAGTATTGCGAGGGAGATAGATCGTGA
 Primer design