SecReT6
Protein ID: 526227380
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1427
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1420397..1421683 [-]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDS5MVF2
KEGG IDsbz:A464_1427
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-58, Aligned region: 5..372
Protein Sequence: 428 a.a.     [Download]
>gi|526227380|ref|YP_008322023.1| Uncharacterized protein ImpJ/VasE [Salmonella bongori N268-08]
MLPQHFQLQALRHEMLTATLARCANPWFWGVIRLEIDEAALCAGTLRVMQLQAIMPDGVPINYDISRDPP
LEFDCARLLPASPDSEHTLWLALSPASRAGQWQLMNTRYRSVNSAPLPDLTSGEFPQSVPLWQPMPHLVS
QHERADFICLPLIQVVYSEGGFRRNEWFAPMPALEHESYPWRHARQICLQAREKILFLNREIQLARQNQR
TTDGLWLTLSLQSIQGGLVFLESLLNSGHVHPVDLYRALCLFAGQTAILTQEKTLPLLPEFDYQDMYAAF
TSLFALLRNQLAHIHRRWQRLNFNRQENSFTLTLPAGIRAGDQIIIGVLMPNGCTMPAQSWLQQSIIASQ
PFLAVLRRQRMHGMTISPLPAERRSDWEIDNSITLFTLTLVTNWFEKETPLIISPLHETDSIPERIMLYR
QEDHYDAC
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|526225953|ref|NC_021870.1|:c1421683-1420397 Salmonella bongori N268-08, complete genome
ATGCTGCCGCAGCACTTTCAACTACAAGCGCTACGCCATGAAATGCTTACAGCAACCCTGGCGCGCTGCG
CCAATCCCTGGTTCTGGGGCGTGATACGGCTGGAAATCGACGAGGCGGCATTATGCGCGGGAACCTTACG
CGTTATGCAACTGCAGGCGATAATGCCGGACGGAGTGCCCATCAATTACGATATAAGCCGCGATCCGCCG
CTGGAATTCGACTGCGCCAGGCTGTTGCCCGCCTCCCCGGATAGCGAACATACGTTATGGCTGGCGCTGT
CGCCCGCCAGCCGCGCCGGGCAGTGGCAGCTAATGAATACCCGATATCGCTCGGTAAATAGCGCACCATT
ACCCGACTTAACCAGCGGCGAATTTCCGCAAAGTGTTCCACTCTGGCAACCGATGCCACACCTGGTGAGC
CAGCATGAGCGCGCCGATTTCATCTGTTTGCCGCTGATTCAGGTGGTCTATAGCGAAGGAGGATTTCGCC
GCAATGAGTGGTTCGCACCGATGCCTGCACTGGAGCACGAGAGCTACCCCTGGCGCCACGCCCGACAGAT
ATGCCTTCAGGCCCGGGAGAAAATCCTTTTTCTCAACCGCGAAATCCAGTTGGCCCGGCAGAATCAAAGA
ACGACAGACGGGCTGTGGTTAACCCTATCGCTGCAAAGTATTCAGGGCGGTCTTGTGTTTCTTGAATCGT
TGCTTAACAGCGGGCACGTACACCCTGTCGATCTTTACCGCGCGCTCTGTTTGTTCGCCGGGCAAACGGC
CATCTTAACCCAGGAGAAAACTCTGCCGTTGCTGCCTGAGTTTGATTACCAGGATATGTACGCGGCGTTT
ACCTCGCTTTTTGCTCTGCTGCGCAATCAACTGGCACATATTCATCGCCGCTGGCAACGCCTTAATTTCA
ACCGACAGGAAAATAGCTTTACCCTGACGCTACCTGCCGGCATCCGTGCGGGCGATCAGATCATTATCGG
CGTATTAATGCCGAACGGCTGTACGATGCCGGCGCAGAGCTGGCTTCAGCAAAGCATTATCGCCAGCCAG
CCGTTTTTAGCGGTTTTACGCCGCCAGCGGATGCATGGCATGACCATTTCGCCACTACCGGCAGAGCGGC
GTAGCGACTGGGAAATTGATAATAGCATCACGCTGTTTACCCTTACCCTGGTCACTAACTGGTTTGAAAA
GGAAACACCGCTGATTATTTCGCCGCTGCATGAGACCGACAGTATACCGGAGCGGATCATGCTTTACCGC
CAGGAGGACCATTACGATGCCTGTTAA
 Primer design