SecReT6
Protein ID: 526227382
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1429
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1422531..1423082 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDS5N7R9
KEGG IDsbz:A464_1429
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.60E-55, Aligned region: 22..174
Protein Sequence: 183 a.a.     [Download]
>gi|526227382|ref|YP_008322025.1| Uncharacterized protein ImpB [Salmonella bongori N268-08]
MHQEYYCDKKGLNMAESIQHKLNRIRPPRVQITYDVETGGAIEKKELPLVVGILADLSGQPATPPEKLRE
RRFVEIDRDNFDDVLASIAPRLALQVENRLANDGSKFNIELNFKTFEDFSPRNIIDQVKPLQRLFLARQR
LRDLLTKLDGNDDLDALLQQVINDNAELQALRPAAAERPAENA
 
Nucleotide Sequence: 552 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1422531-1423082 Salmonella bongori N268-08, complete genome
ATGCACCAGGAATACTATTGCGATAAAAAAGGATTGAATATGGCAGAGAGCATTCAGCATAAACTTAATC
GTATTAGGCCGCCGCGAGTACAAATCACCTATGATGTGGAAACCGGCGGGGCGATTGAGAAAAAAGAACT
TCCGTTAGTGGTGGGTATACTGGCGGATTTATCCGGGCAGCCTGCGACCCCGCCAGAAAAATTACGAGAG
CGCCGTTTTGTCGAAATCGATCGGGATAACTTTGATGATGTGCTTGCTTCAATAGCGCCCCGTCTGGCGC
TGCAGGTTGAAAACCGGCTGGCGAACGATGGCAGTAAATTTAATATTGAGCTCAACTTCAAAACCTTTGA
AGACTTTTCTCCCCGCAACATTATCGATCAGGTTAAGCCCCTCCAGCGCTTATTTCTGGCGCGGCAGCGC
CTGCGCGATCTGCTCACTAAACTGGATGGTAATGATGATTTGGACGCGTTGTTGCAACAGGTCATCAACG
ACAATGCCGAACTTCAGGCACTGCGCCCGGCCGCAGCAGAACGTCCGGCCGAAAACGCGTAA
 Primer design