SecReT6
Protein ID: 526227383
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1430
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1423103..1424584 [+]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDS5MPH8
KEGG IDsbz:A464_1430
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-187, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|526227383|ref|YP_008322026.1| Uncharacterized protein ImpC [Salmonella bongori N268-08]
MDNVQEHADTGGKTVTLSVLDRIIQEGRMARDELQQTYARDMLEELATQILDEGMSVDSDTVAMINHRIA
QIDELISAQLNDVLHHPDMQKLEASWRGLHQFVMNTETSTRLKLRLLNVSRNELQTDLEKAVEFDQSTLF
KKLYEDEYGTFGGNPYSVLVGDFEFGRHPQDVALLEKISQVAAAAHAPFIAAASPRLFDMGSFADLSVPR
DLAKIFESAELMKWRAFRESEDSRYVSLVLPHVLQRLPYGPDTVPVEGVNFVEDVDGLDASKYLWGNAAW
ALAGRITEAFALYGWCAAIRGVEGGGLVENLPAHTFSTPSGDISLRCPTEVAITDRREKELNDLGFIALC
HKKNSNTAAFFGGQTTNQAKIYNTPEANANARISAMLPYILAASRFAHYLKVIMRDKVGSFMSRDEVESY
LNNWIADYVLLTDSAPQEIKARYPLREARVDVSEVPGKPGVYRAVVFLRPHFQLEELTTSIRLVAELPPP
AAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1423103-1424584 Salmonella bongori N268-08, complete genome
ATGGATAATGTTCAGGAACACGCTGATACTGGCGGGAAAACGGTTACGCTGAGCGTACTGGATCGCATCA
TTCAGGAAGGCCGCATGGCGCGCGACGAGCTACAGCAGACCTACGCACGCGATATGCTCGAAGAGTTGGC
GACACAGATCCTGGATGAAGGGATGTCGGTGGACAGCGACACCGTGGCGATGATCAATCATCGTATCGCG
CAAATTGATGAGCTGATCAGCGCCCAGCTCAATGACGTGCTGCATCACCCTGATATGCAGAAACTGGAAG
CCTCATGGCGCGGGCTGCACCAGTTTGTGATGAATACGGAGACCAGCACCCGCCTGAAACTGCGCCTGCT
GAACGTTTCGCGCAACGAACTACAGACCGATCTTGAGAAAGCTGTCGAGTTTGATCAGAGCACGCTGTTT
AAGAAGCTGTATGAAGATGAGTATGGCACTTTCGGCGGCAATCCGTACAGCGTACTGGTCGGCGATTTTG
AGTTTGGCCGCCATCCGCAGGATGTGGCGTTGCTGGAGAAAATCTCTCAGGTCGCAGCGGCGGCCCATGC
GCCTTTTATCGCCGCCGCCAGCCCACGGTTATTTGATATGGGATCGTTTGCCGATTTGAGCGTACCGCGC
GATTTGGCGAAAATTTTTGAGAGTGCTGAACTGATGAAGTGGCGAGCGTTCCGGGAAAGCGAAGACTCCC
GCTACGTATCGCTGGTGCTGCCGCATGTGTTGCAGCGTTTGCCTTATGGCCCGGATACGGTACCGGTTGA
AGGCGTCAACTTTGTCGAAGATGTCGACGGGCTGGATGCGAGTAAATATCTGTGGGGCAACGCCGCGTGG
GCGCTGGCGGGGCGGATAACGGAAGCTTTTGCTCTGTATGGCTGGTGCGCGGCGATTCGCGGCGTGGAAG
GGGGCGGTCTGGTGGAAAATCTGCCAGCGCATACGTTCTCCACCCCTTCCGGTGACATCAGCCTGCGCTG
CCCGACGGAAGTGGCGATTACCGACCGGCGTGAGAAAGAACTTAACGATCTCGGCTTTATCGCCCTGTGC
CACAAGAAAAACAGCAATACCGCCGCCTTCTTTGGCGGACAGACCACCAATCAGGCGAAAATCTACAATA
CCCCGGAAGCCAACGCTAACGCGCGTATTTCCGCCATGTTGCCTTATATTCTTGCCGCCTCTCGCTTTGC
GCACTATCTGAAGGTGATCATGCGTGACAAAGTCGGCAGTTTTATGAGCCGTGATGAGGTCGAAAGCTAT
CTGAATAACTGGATTGCCGATTATGTGTTGCTGACCGACAGCGCGCCGCAGGAGATCAAAGCGCGTTATC
CGCTGCGCGAGGCTCGCGTTGATGTCAGCGAAGTGCCGGGCAAACCGGGCGTTTATCGTGCCGTCGTTTT
TCTGCGCCCGCACTTCCAGCTAGAAGAGTTGACCACCTCGATTCGTCTGGTCGCTGAACTGCCGCCGCCG
GCCGCCGCCTGA
 Primer design