SecReT6
Protein ID: 526227384
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1431
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1424603..1425079 [+]
ProductPutative cytoplasmic protein USSDB7A
NoteTssD
UniProt IDS5NEG0
KEGG IDsbz:A464_1431
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-41, Aligned region: 5..135
Protein Sequence: 158 a.a.     [Download]
>gi|526227384|ref|YP_008322027.1| Putative cytoplasmic protein USSDB7A [Salmonella bongori N268-08]
MDAIFLKLDDIKGECQVDGFKDQIEIMSYSHNVAMQVTNDVSNTERTSGRAHVGEMSLTKFVDLSTPKLN
EYCCGGKMIKEGTLTLCRNDDGKMLPFIVYTLTNVLISHLSVSGGSGGKPVETMSLNFTKIKWEITAQKV
GGQKEGNVSSLWDMAMNK
 
Nucleotide Sequence: 477 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1424603-1425079 Salmonella bongori N268-08, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACGATATCAAAGGTGAATGTCAGGTCGATGGGTTTAAAGATCAGA
TAGAAATTATGTCCTACAGCCATAACGTGGCGATGCAGGTCACCAACGACGTCAGTAATACCGAGCGCAC
TTCCGGACGGGCGCATGTGGGGGAAATGTCGCTGACCAAATTTGTCGATCTTTCCACGCCGAAGCTTAAT
GAGTACTGCTGTGGCGGCAAAATGATCAAAGAAGGGACTCTGACGCTATGCCGTAATGACGATGGCAAAA
TGCTGCCGTTTATCGTTTATACCCTGACCAACGTATTGATCTCGCATCTGAGCGTCAGCGGCGGCTCCGG
CGGTAAGCCAGTCGAAACGATGTCACTCAATTTCACCAAAATTAAATGGGAAATCACCGCGCAGAAGGTG
GGGGGGCAGAAAGAGGGCAACGTCTCATCCCTCTGGGATATGGCGATGAATAAATAA
 Primer design