SecReT6
Protein ID: 526227385
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1432
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1425092..1425469 [+]
Productputative cytoplasmic protein
NoteTssE
UniProt IDS5MVF8
KEGG IDsbz:A464_1432
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.20E-13, Aligned region: 21..112
Protein Sequence: 125 a.a.     [Download]
>gi|526227385|ref|YP_008322028.1| putative cytoplasmic protein [Salmonella bongori N268-08]
MQASIPVALFDRLLDEEISPGESVRRELVRLFNSRAPADADELPPLLAWGVPEWHGLNVGDERVLDGYCR
QLRAAILRCEPRIKTLSISVKDAYQQTLMLHLDAELRDETEPLSLLLVWQDGRWQ
 
Nucleotide Sequence: 378 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1425092-1425469 Salmonella bongori N268-08, complete genome
ATGCAAGCCTCCATTCCGGTCGCGCTGTTTGACCGACTGCTGGATGAGGAGATAAGCCCCGGAGAGTCGG
TGCGCCGGGAGTTGGTTCGTCTTTTCAACTCCCGTGCGCCCGCAGATGCTGACGAATTACCACCGCTGCT
CGCCTGGGGCGTGCCGGAGTGGCACGGTCTCAATGTGGGCGATGAGCGGGTGCTCGACGGGTACTGCCGT
CAGCTACGCGCGGCGATTCTGCGTTGTGAACCGAGAATTAAGACGCTGAGTATCAGCGTGAAAGATGCGT
ATCAGCAGACGCTGATGCTGCATCTGGACGCTGAACTACGCGACGAGACTGAACCGCTGAGCCTGCTACT
GGTCTGGCAAGACGGTCGATGGCAATAA
 Primer design