SecReT6
Protein ID: 526227386
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1433
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1425488..1427209 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDS5MVJ1
KEGG IDsbz:A464_1433
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.40E-131, Aligned region: 5..559
Protein Sequence: 573 a.a.     [Download]
>gi|526227386|ref|YP_008322029.1| Protein ImpG/VasA [Salmonella bongori N268-08]
MDDRLLDDYLQELRWLRTVSGEFARQHPNVAARLRLSEFDCPDPHVERLLEGFALQSARLQRRLDDGFSE
LSASLLELLSPHLMRPFPASATACFTPDPLAGDLTHGYTLPAGTPLYALTKSGETVWWRTTLAQTLWPVV
IETLEWCDASVAQHYSGLQQARSALRIQLRCLPPYRFSTLAMKSLRICLNGSPQINATLFDLLYAHTIGP
LRPQPAGLRHAEQILPCESAVESGGLALSAWIHAPQALMYFDLTITPGGEEEILTLCIPFNQAPDSPLPL
QPHDIRLGCTPVVNLFPRTAEPLMVDHRRSEYRLVADHHDKNIQIYRVQALWLSHQQKACNVPPYYSAQG
HSDARWFWYARRNDKEDNALWLTLVDSRFDPRESAEEASMTAKLWCSNGETAVQLPADSPLIFDFPGPIA
RVQLSGTPTPPSSPARQHDARWKLVSSLALNHLSLLEGETALASLKEMLALYASSGASAAVWQQINGISD
MRCERVSEHYGQDAWRGWRNGIRVTLTLDPAAFTASSRLLFAAIVARFLARNATANCFVHTVLQDEEEAL
PLWSETGQSALIA
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1425488-1427209 Salmonella bongori N268-08, complete genome
ATGGACGATCGATTACTGGATGACTATCTGCAAGAGCTCAGGTGGCTGCGTACGGTAAGCGGCGAGTTTG
CCCGCCAGCACCCGAACGTCGCCGCCCGGCTTCGCCTGAGCGAGTTCGACTGTCCCGATCCGCATGTGGA
ACGGCTGCTGGAAGGGTTCGCCCTGCAAAGCGCCCGCCTGCAACGCCGGCTGGACGACGGTTTCAGCGAA
CTCAGCGCTTCGCTGCTGGAGCTGCTTTCTCCGCATCTGATGCGGCCTTTTCCCGCCAGCGCCACCGCCT
GTTTTACCCCCGACCCGCTGGCGGGCGATCTGACCCACGGTTATACCCTGCCTGCCGGCACGCCGCTGTA
CGCGCTGACGAAGAGCGGCGAAACGGTCTGGTGGCGCACCACCCTTGCGCAAACGCTATGGCCTGTCGTT
ATCGAGACGCTGGAGTGGTGCGACGCCTCAGTTGCGCAACACTACAGTGGCCTGCAACAGGCACGCAGCG
CACTACGCATCCAATTACGCTGTTTGCCGCCATACCGTTTTTCGACGCTGGCGATGAAATCGTTGCGCAT
CTGTCTTAACGGGTCGCCGCAGATTAACGCTACGCTGTTTGATTTGCTTTACGCACACACCATCGGCCCG
CTGCGCCCACAGCCCGCAGGCCTGCGCCATGCGGAGCAGATATTGCCCTGCGAATCCGCTGTGGAGTCGG
GGGGCTTGGCCTTAAGCGCCTGGATCCACGCGCCACAGGCATTAATGTATTTTGATTTGACGATAACGCC
AGGCGGCGAGGAGGAGATCCTGACGCTCTGCATTCCGTTTAATCAGGCACCTGATTCGCCGCTGCCTCTT
CAACCGCACGATATTCGCCTTGGCTGCACGCCGGTGGTGAATCTCTTTCCCCGTACCGCAGAGCCGCTGA
TGGTGGATCACCGGCGTAGCGAATACCGGCTGGTGGCCGATCATCATGATAAAAATATCCAGATCTATCG
CGTGCAAGCGCTATGGCTGAGTCATCAGCAAAAGGCCTGCAACGTACCGCCGTACTACTCAGCGCAGGGG
CACAGCGACGCCCGCTGGTTCTGGTACGCGCGGCGCAACGACAAAGAGGATAACGCGCTGTGGCTGACGC
TGGTGGATAGCCGGTTCGACCCGAGGGAAAGCGCTGAAGAAGCCAGCATGACGGCAAAATTGTGGTGCAG
CAATGGCGAAACGGCTGTGCAACTTCCTGCTGACAGTCCGCTGATTTTCGACTTTCCCGGCCCGATAGCC
CGGGTACAGTTGTCAGGAACGCCCACACCGCCATCATCGCCAGCGCGTCAGCATGACGCCCGCTGGAAGC
TGGTCTCTTCGTTGGCGCTGAATCACCTGTCGCTGCTGGAGGGCGAAACGGCGCTGGCGTCGCTTAAAGA
GATGCTGGCCCTGTATGCCTCATCCGGCGCATCGGCAGCCGTCTGGCAACAAATCAATGGTATCAGCGAT
ATGCGCTGCGAGCGGGTGAGTGAGCATTACGGGCAGGACGCCTGGCGCGGATGGCGCAACGGTATCCGGG
TCACGCTGACGCTGGATCCCGCCGCGTTTACCGCCAGTAGCCGGCTGCTGTTTGCCGCCATTGTCGCCCG
TTTTCTGGCGCGTAACGCCACGGCGAACTGTTTTGTGCATACCGTATTACAGGATGAAGAGGAGGCGCTG
CCGTTATGGAGCGAGACCGGGCAGAGCGCATTGATAGCGTAA
 Primer design