SecReT6
Protein ID: 526227387
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1434
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1427173..1428111 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDS5N7S3
KEGG IDsbz:A464_1434
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-41, Aligned region: 19..291
Protein Sequence: 312 a.a.     [Download]
>gi|526227387|ref|YP_008322030.1| Uncharacterized protein ImpH/VasB [Salmonella bongori N268-08]
MERDRAERIDSVIAQLRREPWRFSLEQCVRLLQLCGDSPQLCGELGLAFTPSETGVLRDGRLQVRSLGPG
GADGVLPYAWLEVLQQAAQDKVRAPQNFLNLFQRRLFAHHYRSLSLYRLATPYARREDAPGFAIMRALCG
FDSKAQQDAATPNILAYSGLLANRRRSTAGFVTLVAAVLNITVHTEEFIGRWQALPPAAISRTGCRLGRN
SVAGRHAWNQHAALRLHLQARDAVQWRDFLPGGRGFIQLGWLGRLWFGAGVELLLMMRGTLRLDNHLDRA
RPPCLGYSAQLTGRRLTSFCCQQSLKESVKWI
 
Nucleotide Sequence: 939 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1427173-1428111 Salmonella bongori N268-08, complete genome
ATGGAGCGAGACCGGGCAGAGCGCATTGATAGCGTAATCGCGCAACTGCGCCGCGAACCGTGGCGCTTTT
CGCTGGAGCAGTGCGTCAGGTTGCTGCAACTGTGCGGCGACTCGCCGCAGTTGTGTGGTGAGCTGGGACT
GGCGTTTACGCCTTCGGAAACCGGCGTGCTGCGCGACGGCAGGTTACAGGTTCGCAGCCTCGGCCCTGGC
GGCGCAGACGGCGTTTTGCCTTACGCCTGGCTGGAAGTGTTGCAACAGGCCGCGCAGGATAAGGTACGGG
CGCCGCAGAATTTTTTAAATCTGTTTCAGCGCCGCTTATTTGCCCATCACTATCGCAGTCTGAGCCTGTA
CCGGCTGGCGACGCCCTACGCCCGTCGTGAAGACGCGCCGGGGTTTGCCATTATGCGCGCGTTGTGTGGT
TTTGATAGTAAGGCGCAACAGGACGCTGCGACGCCTAACATTCTGGCGTACAGCGGACTACTGGCCAATC
GCAGACGGTCAACGGCTGGTTTTGTGACGCTGGTTGCCGCGGTACTTAATATTACGGTGCATACCGAAGA
GTTTATCGGCCGCTGGCAGGCACTGCCGCCTGCCGCCATCAGCCGCACCGGTTGTCGTCTGGGGCGCAAC
AGCGTGGCAGGAAGGCACGCCTGGAATCAGCATGCGGCGCTGCGCCTGCATTTGCAGGCCCGCGACGCGG
TGCAGTGGCGGGATTTTCTCCCCGGCGGCAGGGGATTTATCCAGCTTGGCTGGCTCGGCAGACTCTGGTT
TGGCGCAGGGGTGGAACTGCTGCTAATGATGAGAGGAACGCTGCGTCTGGATAATCATCTGGATCGCGCC
AGGCCGCCGTGTCTGGGTTACAGCGCACAACTGACCGGACGCCGCCTCACGTCGTTTTGTTGCCAACAAT
CTCTTAAGGAGAGCGTTAAATGGATTTAA
 Primer design