SecReT6
Protein ID: 526227388
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1435
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1428102..1430615 [+]
ProductClpB protein
NoteTssH
UniProt IDS5MPI3
KEGG IDsbz:A464_1435
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-38, Aligned region: 214..232
AAA_2 [PF07724], Evalue: 1.20E-38, Aligned region: 603..766
AAA [PF00004], Evalue: 3.70E-21, Aligned region: 215..347
AAA [PF00004], Evalue: 3.70E-21, Aligned region: 609..726
AAA_5 [PF07728], Evalue: 4.70E-16, Aligned region: 215..235
AAA_5 [PF07728], Evalue: 4.70E-16, Aligned region: 291..345
AAA_5 [PF07728], Evalue: 4.70E-16, Aligned region: 608..726
Clp_N [PF02861], Evalue: 4.20E-11, Aligned region: 21..70
Clp_N [PF02861], Evalue: 4.20E-11, Aligned region: 104..120
AAA_22 [PF13401], Evalue: 9.70E-10, Aligned region: 215..300
AAA_22 [PF13401], Evalue: 9.70E-10, Aligned region: 343..385
AAA_22 [PF13401], Evalue: 9.70E-10, Aligned region: 606..713
AAA_16 [PF13191], Evalue: 1.20E-09, Aligned region: 192..236
AAA_16 [PF13191], Evalue: 1.20E-09, Aligned region: 260..293
AAA_16 [PF13191], Evalue: 1.20E-09, Aligned region: 591..650
AAA_16 [PF13191], Evalue: 1.20E-09, Aligned region: 673..700
AAA_25 [PF13481], Evalue: 9.60E-08, Aligned region: 215..288
AAA_25 [PF13481], Evalue: 9.60E-08, Aligned region: 425..474
AAA_25 [PF13481], Evalue: 9.60E-08, Aligned region: 605..633
AAA_17 [PF13207], Evalue: 2.10E-07, Aligned region: 147..210
AAA_17 [PF13207], Evalue: 2.10E-07, Aligned region: 215..270
AAA_17 [PF13207], Evalue: 2.10E-07, Aligned region: 607..646
Zeta_toxin [PF06414], Evalue: 3.00E-07, Aligned region: 215..236
Zeta_toxin [PF06414], Evalue: 3.00E-07, Aligned region: 600..648
AAA_14 [PF13173], Evalue: 6.60E-07, Aligned region: 215..315
AAA_14 [PF13173], Evalue: 6.60E-07, Aligned region: 607..698
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 212..239
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 606..630
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 208..234
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 608..628
Sigma54_activat [PF00158], Evalue: 8.50E-06, Aligned region: 196..231
Sigma54_activat [PF00158], Evalue: 8.50E-06, Aligned region: 608..707
AAA_18 [PF13238], Evalue: 8.60E-06, Aligned region: 215..235
AAA_18 [PF13238], Evalue: 8.60E-06, Aligned region: 343..390
AAA_18 [PF13238], Evalue: 8.60E-06, Aligned region: 609..640
T2SE [PF00437], Evalue: 3.20E-05, Aligned region: 203..231
T2SE [PF00437], Evalue: 3.20E-05, Aligned region: 579..686
ResIII [PF04851], Evalue: 3.60E-05, Aligned region: 205..239
ResIII [PF04851], Evalue: 3.60E-05, Aligned region: 285..297
ResIII [PF04851], Evalue: 3.60E-05, Aligned region: 580..630
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 215..243
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 608..634
AAA_23 [PF13476], Evalue: 0.00029, Aligned region: 215..232
AAA_23 [PF13476], Evalue: 0.00029, Aligned region: 423..477
AAA_23 [PF13476], Evalue: 0.00029, Aligned region: 606..633
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 193..227
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 267..300
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 607..650
RNA_helicase [PF00910], Evalue: 0.00086, Aligned region: 216..236
RNA_helicase [PF00910], Evalue: 0.00086, Aligned region: 609..630
AAA_33 [PF13671], Evalue: 0.0013, Aligned region: 215..232
AAA_33 [PF13671], Evalue: 0.0013, Aligned region: 607..629
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 214..232
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 285..295
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 566..629
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 677..701
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 215..238
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 355..384
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 493..517
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 607..644
SRP54 [PF00448], Evalue: 0.0018, Aligned region: 771..830
Torsin [PF06309], Evalue: 0.003, Aligned region: 565..631
AAA_29 [PF13555], Evalue: 0.0073, Aligned region: 207..227
AAA_29 [PF13555], Evalue: 0.0073, Aligned region: 604..633
AAA_28 [PF13521], Evalue: 0.0077, Aligned region: 215..241
AAA_28 [PF13521], Evalue: 0.0077, Aligned region: 420..420
AAA_28 [PF13521], Evalue: 0.0077, Aligned region: 608..628
Protein Sequence: 837 a.a.     [Download]
>gi|526227388|ref|YP_008322031.1| ClpB protein [Salmonella bongori N268-08]
MDLKMLVQKLNPVCLRALEQAAERSRAQGHWFVEPEHLLLALLDDEHCDFVCCLNGAAIPVDALRDEILR
AQGQFKTGCTRMPVFSLQLVELLEGAILQATFQNHTEVRSALILLALLTRDRLRVQLAQGMPLLLKIPTE
MLENQWREWCRGAAEDAAKPVKGETPRHSGGVLEQYTHDLTRDARDGKIDPIIGRESEIRQCIDILLRRR
QNNPILVGAPGVGKTAVAEGLALRIAEGKVPPPLREVVLLSLDLGLLQAGAGVKGEFEQRLRGVIEAVKK
SPQPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTIAATTWQEYKKYFEKDPALDRRFQRIQI
EEPDENGAVVMLRAVADKLEAHHGVQILDTAIREAVRLSQRYISGRQLPDKAISVLDTACARVALAQHDV
PPQLEEIRQHLAAIEEESARLNRELLVGVDHHDRLCELAAQAEKLHQQAREVEERWQDERQRVGELQAAR
QRMLDLSVRLEEDDELEEELVECAALIGKLETAAAQLREEVPLVPDCVDPATVASVISGWTGIPIGQMQT
DEAHALRTLVDRMSERVMGQQMALETIAQRLRAYRSGLTDPQKPVGVFLLVGPTGVGKTETAYALADALY
GGERNLITINLSEYQEAHTVSQLKGAPPGYVGYGSGGALTEAVRRRPYSVVLLDEIEKAHPDVLEAFYNV
FDKGVMEDGTGLIVDFKNTVMLATSNVGAELILDTPVSELKSERFNEALREELLRHFRPAFLARMTTVAY
RALDEEVLKGIVLAKLEKLAQRYLVATGEKLNIINNIALDLSFFSRAGDVRNIENMLINKILEKNRI
 
Nucleotide Sequence: 2514 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1428102-1430615 Salmonella bongori N268-08, complete genome
ATGGATTTAAAAATGCTGGTACAAAAACTTAATCCGGTTTGTTTACGCGCCCTGGAGCAGGCAGCAGAAC
GCAGCCGGGCGCAGGGCCACTGGTTCGTGGAGCCGGAACATTTGTTACTGGCGTTACTGGATGATGAGCA
TTGTGATTTCGTTTGCTGTCTTAACGGCGCGGCGATCCCGGTTGACGCTCTGCGCGATGAGATCCTGCGC
GCGCAGGGGCAGTTCAAAACAGGCTGTACGCGGATGCCGGTATTTTCTTTGCAACTGGTTGAGTTGCTGG
AGGGTGCCATTTTACAGGCGACCTTTCAGAATCATACCGAGGTACGTTCCGCGCTGATATTGTTGGCATT
ACTGACTCGTGACCGCCTGCGCGTCCAACTGGCGCAGGGAATGCCGCTGCTGTTGAAAATTCCCACTGAG
ATGCTGGAGAACCAATGGCGAGAGTGGTGCCGGGGAGCGGCGGAAGATGCGGCAAAACCGGTAAAAGGCG
AAACCCCACGGCATAGTGGCGGCGTGCTTGAACAATACACCCACGATCTGACCCGCGACGCGCGGGACGG
AAAGATTGACCCGATCATCGGGCGCGAGAGCGAGATCCGCCAGTGCATCGATATCCTGCTACGCCGTCGG
CAGAACAACCCGATTCTGGTCGGCGCGCCCGGCGTTGGGAAAACCGCCGTCGCCGAGGGACTGGCGCTGC
GTATTGCCGAAGGCAAGGTACCGCCTCCCCTGCGCGAGGTGGTGTTACTTTCGCTCGATCTTGGCCTGCT
ACAGGCCGGTGCGGGCGTGAAAGGCGAGTTTGAACAGCGTTTGCGCGGCGTGATCGAGGCGGTAAAAAAA
TCCCCGCAGCCGATTATTCTGTTTATCGACGAGGCCCATACGCTGATTGGCGCGGGCGGCGCCGAAGGCG
GCAGCGACGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCGAACTGCGTACCATCGCCGCCACTAC
CTGGCAGGAGTATAAAAAATATTTCGAGAAAGATCCGGCTCTGGACCGCCGTTTCCAGCGTATCCAGATT
GAAGAGCCGGACGAGAACGGTGCGGTGGTGATGCTGCGGGCGGTGGCCGATAAACTGGAGGCGCATCACG
GCGTGCAAATTCTGGATACCGCCATCCGCGAGGCGGTGCGCCTCTCGCAGCGCTATATCTCTGGTCGCCA
GTTGCCGGACAAAGCAATCAGCGTGCTCGATACCGCCTGCGCGCGGGTGGCGCTGGCGCAGCATGACGTG
CCGCCCCAGCTGGAGGAGATCCGCCAGCATCTGGCGGCCATCGAGGAAGAGAGCGCGCGCCTGAACCGCG
AACTGCTGGTGGGCGTCGATCATCACGACAGGCTGTGCGAACTGGCGGCGCAGGCGGAAAAACTCCACCA
GCAGGCGCGGGAGGTGGAGGAGCGCTGGCAGGATGAGCGCCAGCGGGTCGGCGAGCTACAGGCAGCCCGC
CAGCGGATGCTGGATCTCAGCGTGCGGCTGGAAGAAGACGATGAACTGGAAGAGGAGCTGGTGGAGTGCG
CGGCACTGATCGGCAAACTGGAAACCGCCGCCGCCCAGCTACGTGAGGAAGTGCCGCTGGTGCCGGACTG
CGTCGATCCCGCCACCGTGGCTTCAGTGATCAGCGGCTGGACCGGGATCCCGATAGGCCAGATGCAGACC
GATGAAGCCCACGCTCTGCGCACCCTGGTAGACCGGATGAGCGAGCGTGTGATGGGGCAGCAGATGGCGC
TGGAGACTATCGCCCAGCGCCTGCGCGCCTACCGCAGCGGCCTGACCGATCCGCAAAAGCCGGTCGGCGT
GTTCCTGCTGGTGGGGCCAACCGGTGTGGGCAAAACCGAAACTGCCTATGCGCTGGCCGACGCCCTCTAC
GGCGGCGAACGCAATCTGATCACCATCAACCTGTCTGAATATCAGGAGGCGCACACCGTCAGCCAGCTTA
AAGGCGCGCCGCCGGGCTACGTTGGCTATGGTAGCGGCGGGGCGTTAACCGAAGCGGTGCGCCGTCGGCC
TTATTCGGTGGTGCTGCTCGACGAAATCGAAAAGGCACACCCGGACGTGCTGGAGGCGTTTTATAACGTC
TTCGACAAAGGGGTAATGGAAGACGGCACCGGGCTGATCGTTGATTTTAAAAACACAGTGATGCTGGCGA
CCAGCAACGTCGGCGCGGAATTAATTCTCGATACCCCGGTTAGTGAATTAAAGAGTGAGCGCTTTAACGA
GGCATTGCGCGAGGAGCTGTTGCGTCATTTCCGTCCGGCGTTTTTAGCAAGAATGACTACGGTGGCGTAC
CGGGCGTTAGATGAAGAAGTATTAAAAGGGATTGTGCTGGCGAAACTGGAGAAATTAGCTCAGCGGTATT
TAGTGGCGACGGGGGAGAAGTTGAATATTATAAATAATATAGCTTTAGATTTATCATTTTTTTCCAGGGC
AGGGGATGTGAGAAATATAGAAAATATGCTTATAAATAAAATCCTTGAAAAAAATAGAATTTAA
 Primer design