SecReT6
Protein ID: 526227390
SecReT6 ID828
T6SS typei4a
Gene symbol-
Locus tagA464_1437
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]1431825..1433789 [+]
ProductVgrG protein
NoteTssI
UniProt IDS5MVG2
KEGG IDsbz:A464_1437
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-67, Aligned region: 28..313
Phage_base_V [PF04717], Evalue: 1.40E-24, Aligned region: 342..435
Gp5_C [PF06715], Evalue: 2.10E-13, Aligned region: 477..487
Gp5_C [PF06715], Evalue: 2.10E-13, Aligned region: 489..511
Gp5_C [PF06715], Evalue: 2.10E-13, Aligned region: 506..522
Gp5_C [PF06715], Evalue: 2.10E-13, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 2.10E-13, Aligned region: 548..571
Gp5_C [PF06715], Evalue: 2.10E-13, Aligned region: 626..640
DUF3540 [PF12059], Evalue: 0.0095, Aligned region: 548..636
Protein Sequence: 654 a.a.     [Download]
>gi|526227390|ref|YP_008322033.1| VgrG protein [Salmonella bongori N268-08]
MPDTTIIKLTAPNLTGLTVATAYTDSQLNTLTTATIAATTSAPLTLDASLATHLTATINNADYDALIAEA
RQLPATGNADRYQFVLRSWLWWLTLSSNNRVFQNLSAQEIVEKVFKDGGFSDYKFQLKSKPAKREYCLQY
NESDFNFISRLLEQEGIFWFFTYAEGKHTLVLADDNSAFPPIPGEKKVKYQAAQSGARETGMIRSAQLRL
QATAQGFQSSDFNYEQPKAALFSQAGEKKGGMQYQHPGRFSVKAEGDALAAWKVNALKAQAKQLVGESDC
PALMAGHWFTLTDHDDKSLNIDWLITAVSHEYDGEHYRNRFTAIPKATPYRPLAVTPQPFMHTQTATVVG
KSGEEIWTDKLGRVKVQFPWDREGKSDETSSCWLRVATAWSGNGFGAQFIPRIGQEVVVSFIDGSPDKPL
ITGCVYNGANALPYALPANQTQSGIKTKSEKGFNELRFDDKKDAELLAMQAQKDFQLTVLNDSKTTVSHD
EIQSVKNDRTRIIEEGNETITLKKGNRTVKIEKGSDTLEVKDKRSVTVKGDQEHAVDGNETHKVKGNYTL
NVDGNLTIKVSGTLTLESSKTLNLKSGADLSASATSGLKLDATNIASEAKASLTQKAATISHEAKATLTS
KASATQTVDGGGMLIIKGGLVRIN
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|526225953|ref|NC_021870.1|:1431825-1433789 Salmonella bongori N268-08, complete genome
ATGCCCGACACCACCATCATCAAACTTACCGCCCCGAATCTAACCGGCCTTACCGTTGCGACCGCTTACA
CCGATTCCCAACTTAACACCCTGACCACCGCCACCATTGCCGCAACCACCTCCGCGCCATTAACTCTCGA
TGCCTCACTGGCAACCCATCTAACAGCAACGATAAACAACGCCGACTACGACGCCCTGATTGCCGAAGCG
CGCCAGCTTCCGGCGACCGGCAACGCCGATCGCTATCAGTTTGTGCTGCGCTCGTGGCTGTGGTGGCTGA
CGCTCTCCAGCAACAACCGTGTGTTTCAGAACCTCAGCGCGCAGGAAATCGTCGAGAAAGTATTTAAAGA
CGGCGGATTTAGCGACTACAAATTCCAGCTGAAAAGCAAACCGGCAAAGCGTGAATACTGCCTGCAATAT
AACGAAAGTGATTTTAATTTTATTTCGCGGCTGCTGGAGCAGGAGGGGATTTTCTGGTTCTTCACCTATG
CAGAAGGCAAGCACACGCTGGTGCTGGCGGATGATAATAGCGCTTTCCCGCCGATACCTGGCGAGAAAAA
AGTAAAATATCAGGCGGCACAGAGCGGCGCGCGGGAAACCGGGATGATTCGTTCGGCGCAGCTGCGTCTG
CAGGCCACCGCCCAGGGCTTTCAAAGCAGCGATTTTAACTACGAGCAGCCAAAAGCCGCGCTGTTTTCGC
AGGCAGGTGAGAAGAAGGGTGGCATGCAGTATCAGCATCCGGGCCGCTTTAGCGTCAAAGCCGAAGGCGA
CGCGCTGGCGGCGTGGAAGGTTAACGCCCTGAAGGCGCAGGCGAAACAGCTGGTGGGCGAAAGCGACTGC
CCGGCGCTGATGGCGGGGCATTGGTTCACCCTGACCGATCACGACGACAAATCTCTGAATATCGACTGGC
TAATCACCGCCGTTAGCCATGAATATGACGGCGAACACTATCGCAACCGCTTTACCGCCATCCCGAAGGC
CACGCCGTATCGCCCGCTCGCCGTGACGCCACAGCCCTTTATGCATACGCAAACGGCGACGGTGGTGGGT
AAAAGCGGAGAGGAGATTTGGACCGATAAACTCGGGCGGGTGAAGGTGCAGTTCCCGTGGGACAGAGAGG
GCAAAAGCGACGAAACCAGCTCCTGCTGGCTGCGGGTCGCCACCGCCTGGAGCGGTAACGGTTTCGGCGC
GCAGTTTATCCCGCGCATTGGCCAGGAAGTGGTGGTGAGCTTTATCGACGGCAGCCCGGATAAACCGCTG
ATTACCGGCTGCGTCTACAACGGTGCGAATGCGCTGCCCTATGCACTTCCGGCGAACCAGACCCAGTCAG
GCATTAAAACCAAAAGTGAAAAAGGCTTCAACGAACTACGCTTCGACGATAAAAAAGATGCCGAGCTGCT
GGCGATGCAGGCACAAAAAGATTTTCAGCTCACCGTGCTGAACGACAGTAAAACCACGGTCAGCCATGAC
GAGATCCAGAGCGTCAAAAACGACCGCACCCGCATCATTGAAGAGGGCAATGAAACTATTACCCTGAAAA
AGGGCAACCGGACGGTGAAAATCGAAAAAGGTAGCGACACGCTGGAAGTCAAAGACAAGCGTAGCGTAAC
GGTGAAAGGCGATCAGGAACACGCGGTGGACGGCAACGAGACGCACAAGGTGAAGGGCAACTATACCCTC
AACGTTGACGGCAACCTGACGATCAAGGTCAGCGGCACGTTGACGCTGGAAAGCAGTAAAACTCTGAACC
TGAAAAGCGGGGCTGATCTTAGCGCCAGCGCGACGTCAGGTCTGAAGCTGGACGCCACCAACATCGCCAG
CGAAGCGAAAGCGTCGCTCACCCAGAAAGCGGCCACCATCAGTCATGAAGCGAAGGCCACGCTCACCAGC
AAGGCCAGCGCCACCCAGACGGTGGACGGCGGCGGGATGCTGATTATCAAAGGCGGACTGGTGAGGATTA
ACTGA
 Primer design