SecReT6
Protein ID: 526458070
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4823
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1671046..1675104 [+]
Producthypothetical protein
NoteTssM
UniProt IDS5NMM2
KEGG IDbpse:BDL_4823
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.80E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 7.80E-48, Aligned region: 1111..1151
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 58..92
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 99..246
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 789..825
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 815..852
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 1113..1139
Protein Sequence: 1352 a.a.     [Download]
>gi|526458070|ref|YP_008328600.1| hypothetical protein BDL_4823 [Burkholderia pseudomallei MSHR305]
MMIARIAALLALAALSWASALYFDWPLWGAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALARAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLASPLRRARGDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAN
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
RALDSLDARLGALRVVLAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASV
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDMRAADDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGGVGGVGGVGGVGGVGG
VGGVGGARAAEGAGRAVRASGGRRAGDARAARGMRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVD
LIAWSAPDDRALAARVAAAQAELERLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAAL
RDVRVPAALTAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQ
AQWRAVIDRIADRRDPFAALLARVDREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAA
LGSISRSGGRALREALGGAPEQGRLTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGV
DPSVQASAMRAADSALRDVKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRR
AATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARR
DAERRAQQQAALELDERIASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTN
YNLRVSEQIDWQPDRCGDATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLG
VRHIDVRYDFSGHDALLAHVGRIDALERARRDDLARQRRAANRQDDEAGGATAIARAAASVANAPGAALP
RRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 4059 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1671046-1675104 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTGTGGGGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCGTCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTTGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGCGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCGCGCGCGCGCCTCGCGTCGCCGCTGCGGCGCGCGCGCGGCGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTTGCGATCGACGCGCCGCGCCTCATCGAAGCGAAC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGTGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCGAGCCGGACGGCGCGAGCGACATGCGCGCGGCCGACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTC
TGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGT
GTAGGCGGTGTAGGCGGTGCGCGCGCCGCGGAAGGTGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGC
GCGCAGGCGACGCGCGCGCCGCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCGGCGCCGGCGCTGAAAT
CGCACCCGCCGCAGACGGCGTTCGCGATCGCGACGAAGGGTTCGCGCGCGTCAGCGCGCTCGCCGTCGAC
CTGATCGCGTGGAGCGCGCCCGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCG
AACGGCTCGCGTACCGCGATCCGGACGGCGCGTGGCTGCTCGCGCTGCCGGATGCCTCGATGCCGCGCGA
CGTGACGCTTGCCGATTTCTGGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGTTG
CGCGACGTGCGCGTGCCCGCCGCGCTGACGGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGA
TGGCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGC
ACGGCGCATCGACGCATGGCGCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAA
GCGCAATGGCGCGCGGTGATCGACCGGATCGCCGATCGCCGCGATCCGTTCGCGGCATTGCTCGCGCGCG
TCGATCGCGAATTCGAATCCGAGCGCGACGACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATC
GCACATGCTCGCCCCCGCGATGCTCGCGCCCGCGCGCTTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCG
CTCGGCTCGATCTCGCGCAGCGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGCGCGCCCGAGCAAGGCA
GGCTCACGCTCGAGCGCGACGCCGCGCTGCGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCGCT
CGCCGCCGACGCGCTTGCGGGCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTC
GATCCGTCCGTCCAGGCTTCCGCGATGCGCGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGG
GCGATCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTA
TGTCGAGCGGCAGGCGTCGTGCGCACTGCAGGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGC
GCGGCGACGCGCGACGACGTGGAGGGCCTGCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACG
GCCCGGCGAAGCCGTTCGTGCGTGTCGGCGCGGCGCGTGCGTCGGCGCTCGACACGCTCGGCTACCGGCT
GCCGTTCACCGACGCGTTCCTGCCGCTCATCGACGACGCGGCCGCCCGGCGCGTCGCGCAAGCGCGGCGC
GACGCCGAGCGGCGCGCGCAACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGC
AGATCGACGCGCTGCGCGCGCAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGA
TGCGCAGGCCAAGCCGTTCGAAACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAAC
TACAACCTGCGCGTGTCCGAGCAGATCGACTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCT
CGCTCGGCGGCGTCACGCTCGTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTT
CCGCTACGGCGTGCGCCGCTTCACGCCCCGCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGC
GTGCGCCACATCGACGTGCGTTACGACTTCTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCG
ACGCGCTCGAACGCGCGCGCCGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGAACCGTCAGGACGACGA
AGCGGGCGGCGCGACGGCGATCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCC
CGCCGCATCGGCGTGTGTTGGGGGGACCCGGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTAA
 Primer design