SecReT6
Protein ID: 526471191
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2313
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2691123..2695016 [-]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDS5NM62
KEGG IDbpse:BDL_2313
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.30E-71, Aligned region: 64..107
ImcF-related_N [PF14331], Evalue: 2.30E-71, Aligned region: 189..449
IcmF-related [PF06761], Evalue: 1.60E-53, Aligned region: 494..861
DUF1215 [PF06744], Evalue: 1.80E-28, Aligned region: 993..1108
Protein Sequence: 1297 a.a.     [Download]
>gi|526471191|ref|YP_008342452.1| intracellular multiplication and macrophage-killing family protein [Burkholderia pseudomallei MSHR305]
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLVWAAVALGVALALWLATKLWRRWRVRRANRQLG
DMLEQQAETGKMSAAVAEPAKRAELDVLRTRLADTVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLDLLKRYRPKA
PINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQE
YDRVWGATLPYEPDEKRDVVALFDQRFEELYDGLKEISVAQLSVSRGNKLSPGQLSFPLEFSTIKPALRS
FLATLFEDNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDSQSLPKPHSAFLKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRMRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNVTRLQQNRNDL
QSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGVRQILLAPVSDNLASFLKDVN
AHPDQLAPMTRAPESGATPAGPMPVSTHPAAPGAAPSPAVAQGRQQGGLYNDASPTNVEDAYNALKTYLM
LSDKRHVEQAHLTDQVARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVSDNDWPMIEANLALVDQTR
ENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTRDAWFQYVQPAIRD
AATKELQAKDWVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKQWFTRQPGGQIAANVDINGNPADVPM
GPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLK
FVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQNSLANKYPFAAGAKVE
AGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLSARTWGDMGLALTPDFTGGFARWVAPLAGGAATSA
AASSEPQTVFQVLPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTLQLV
NEPGRYGLEKLINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTGGGDQPQQQSLRGLRLPSSVA
DASAGGAANATAQPGSGAAAAQVAATAASASNAQGAQ
 
Nucleotide Sequence: 3894 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2695016-2691123 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGCAACGCTTCCTCAACGTGTTGACTCACCCTCGCACGCTCACGATCGTCGGCTTCGCCGCGCTCGCGG
CGGTTCTGTTCATCGCGGCCGACGCGCTCCAGATCGGCCTCGTATGGGCGGCCGTCGCGCTCGGTGTCGC
GCTCGCGCTCTGGCTCGCGACGAAGCTCTGGCGCCGCTGGCGCGTGCGCCGCGCGAACCGCCAGCTCGGC
GACATGCTCGAGCAGCAGGCCGAAACGGGCAAGATGTCCGCCGCCGTGGCCGAGCCCGCGAAGCGCGCGG
AGCTCGACGTGCTGCGCACCCGCCTCGCCGACACGGTGAAGACGATCAAGACTTCGAAAATCGGCCAGGT
GTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAATCCGGCCGCGGGCAAGAGC
AGCGCCGTCATCAACTCGGGGTTGCAGTTTCCGTTCGCGGACAAGAACAGCGCGGTGATCCACGGCATCG
GCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGCATCCTGCTCGACACCGCGGGCCGCTATTC
GGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTTCTCGATCTGCTCAAGCGCTATCGCCCGAAGGCC
CCGATCAACGGCATCATCGTGACGGCGAGCATCGCCGAGCTCACCGGCAATCGCCCCGAATTCGCGATCA
ACCTCGCGAAGAACCTGCGCCAGCGCGTGCAGGAGCTCACCGAGAAGCTCGAAGTGTTCGCGCCCGTCTA
CGTGATGTTCACGAAGGCCGACCTGATCACGGGCTTCACCGAATTCTTCAGCAGCAACGATCGCCAGGAA
TACGACCGCGTATGGGGCGCGACGCTGCCGTACGAGCCTGACGAGAAGCGCGACGTGGTCGCGCTGTTCG
ATCAGCGCTTCGAGGAACTGTATGACGGACTCAAGGAAATCAGCGTCGCGCAGTTGTCGGTGAGCCGCGG
CAACAAGCTCTCGCCCGGCCAGTTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCCGCGCTGCGCTCG
TTCCTCGCGACGCTGTTCGAGGACAACCCGTTCCAGTACAAACCGATCTTCCGCGGCTTCTACTTCACGA
GCGCGCTGCAGGAAGGCGAAACGAACAGCGCGGCCGCGCAGCGGATCGCGCACCGCTTCGGGCTCGATTC
GCAAAGCCTGCCGAAGCCGCACAGCGCGTTCTTGAAGAACGGCTTCTTCCTGCGCGACCTGTTTTCGAAG
GTGATCTTCGCCGATCGCCAGACGGTCCGCCAGTTCGCGAGCCCGACGAAGACGCGCATGCGCTACGCGA
CGTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGACGATCGGCAACCA
GCAACTCGTCTCGAACGTGCAGGCCGACCTCGACAACGTGACCCGCCTGCAGCAGAACCGCAACGATCTG
CAATCTCGCCTGCAGGCGATGGACATCCTCGAGGATCGGATCGAGCAGCTCGAGCAGTTCCGGCGCGACA
AGCCGCTGTCCGTCTCGCTCGGCCTGTATCAGGGCAATCGGCTCGAGCAGCACCTGTTGACCGAGTACTA
CAACGGCGTGCGGCAGATCCTGCTCGCTCCCGTGTCGGACAATCTCGCGTCGTTCCTGAAGGACGTGAAC
GCGCATCCGGACCAGCTCGCGCCGATGACGCGCGCGCCCGAATCGGGCGCGACGCCGGCGGGCCCGATGC
CGGTATCGACCCATCCCGCGGCGCCGGGCGCGGCCCCCTCCCCCGCCGTCGCGCAGGGCCGGCAGCAGGG
CGGCCTCTATAACGACGCGTCGCCGACCAACGTCGAGGACGCGTACAACGCGCTGAAGACCTACCTGATG
CTCTCCGACAAGCGGCACGTCGAGCAGGCGCACCTGACCGATCAGGTCGCGCGCTTCTGGCGCGGCTGGC
TCGAGACGAATCGCGGCAACATGCCGCGCGACGAGATGATCAGGAGCGCGGAGCGAATGATCACGTTCTA
CCTGTCGCGCGTGTCCGACAACGACTGGCCGATGATCGAGGCGAATCTCGCGCTCGTCGACCAGACCCGC
GAGAACCTGCGCCGCGTCGTGCGCGGCATGCCGGCCCGCCAGCGCGTGTATGAAGAGATCAAGGCGCGCG
CGTCGACCCGCTTCGCGCCGATGACGATCGCGCGCATCGTCGGCGAAGGCAACACCGGCCTCGTCGCGGG
CAGCTACGCGATCCCCGGCACGTTCACGCGCGACGCGTGGTTCCAGTACGTGCAGCCGGCGATCCGCGAC
GCCGCGACGAAGGAGCTGCAGGCGAAGGATTGGGTGCTGAACACCGCGTCGGCGGACGATCTGACGCTCG
AGGGCAGCCCCGAGCAGATCCAGAAGACGCTCGTCGCGATGTACAAGACCGAGTACGCACAGCACTGGCA
GAAGTTCATGCAGGGCATCGCGGTGCAGGGCTTCGGCAATTTCACGCAGGCGGTCGACGCGATGAACAAG
CTCGGCGATCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAGACCGCGTACGACCAGACCTCGTGGGACA
ACCCGTCGCTCGCGAACGCGACGATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAGTGGTT
CACGCGCCAGCCGGGCGGCCAGATCGCGGCGAACGTCGACATCAACGGCAATCCCGCCGACGTGCCGATG
GGCCCGATCGGCCAGGAGTTCGTCGGGCTCGGCCGGATCGTCGCCACGCACGACGGCACGTCGATGCTCA
AGGGCTACATGGACACGCTGTCGAAGGTCCGCACGCGCTTTAACGTGATCAAGAACCAGGGCGACCCCGG
CCCCGGCGCGCGTCAGCTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTGAAG
TTCGTCGACGAGCAGATGCTCACGGGCTTGACCGATTCGCAACGCAAATCGCTGCGCCCGCTTCTCGTGC
GCCCGCTGATGCAGGCGTTCGCGGTCGTGATCCAGCCGGCGAGCGTCGAGGTGAACAAGGTATGGAACGC
GCAGGTGTACCAGCCGTTCCAGAACTCGCTCGCGAACAAGTATCCGTTCGCGGCGGGCGCGAAGGTCGAG
GCGGGCGCGGGCGAGATCGCGCAGGTGTTCGGCCCCGACGGCTCGATCGCGAAGTTCGTCGGCACGACGC
TCGGCCCGCTCGCGGTGCGCCGCGGCGACACGCTGTCCGCGCGCACCTGGGGCGACATGGGCCTCGCGCT
CACGCCGGACTTCACGGGCGGCTTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCGACGAGCGCG
GCCGCGTCGTCCGAGCCGCAGACCGTGTTCCAGGTGCTGCCGCAGCCGAGCAGCGGCACGACCGAATACA
CGATCGCGATCGACGGCCAGCAGCTGCGCTACCGCAACACGCCGCCGCAATGGACGAACTTCGTGTGGCC
GAACCCGCAGGGCTCGCCCGGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGTTGCAGCTCGTC
AACGAGCCGGGCCGCTACGGCCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCA
CGTTCGATCTGACATGGACGCAGGGCAGCGTCAGCGTCTCGGTGACGATGCGCATCATCAGCACCTCGCA
GCCGACGGGCGGCGGCGATCAGCCGCAGCAGCAAAGCCTGCGCGGCCTGCGCCTGCCTTCGTCGGTCGCC
GACGCGAGCGCGGGCGGCGCGGCCAATGCGACGGCGCAACCCGGCTCGGGCGCCGCGGCCGCGCAGGTCG
CCGCCACGGCCGCTTCCGCATCGAACGCACAGGGGGCGCAATGA
 Primer design