SecReT6
Protein ID: 528837978
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00464
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]491148..494624 [-]
Producttype VI secretion system IcmF family protein
NoteTssM
UniProt IDS5SXC6
KEGG IDrel:REMIM1_PF00464
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-73, Aligned region: 207..447
ImcF-related_N [PF14331], Evalue: 1.30E-73, Aligned region: 512..579
IcmF-related [PF06761], Evalue: 1.90E-68, Aligned region: 497..796
IcmF-related [PF06761], Evalue: 1.90E-68, Aligned region: 846..894
DUF1215 [PF06744], Evalue: 9.60E-36, Aligned region: 899..1020
Protein Sequence: 1158 a.a.     [Download]
>gi|528837978|ref|YP_008369058.1| type VI secretion system IcmF family protein [Rhizobium etli bv. mimosae str. Mim1]
MNPISYFYTLRSYVEAYAGLLGRRFISIIWVAAICVVIWFYGYLAAYGDFKPLASATARLTLIGVVIAAW
LAYLLFTVIRDGRRDKQLVEGIERDAEAEAAASQQAEVGEIHSRLKEALQLLRRITKRRFGYIYELPWYV
IFGAPGSGKTTALTNSGLKFPLGDALGSNSVKGVGGTRNCNWWFTDEAILIDTAGRYTTQDDLNGTAKAG
WEGFLGLLRKYRRSQPINGALVTLSIGDLLTRDPEAQREEIRAIRQRLSELDELLHARVPVYLLLTKADL
LTGFVEFFDGFNKSDREQVWGTTFGLDESYKAANLPERFTEEFTLLQQRVDAMLIERLQQEPNPELRGRI
FRFPAELASLKERLHEVTTELCSGSKLVEAPLLRGIYFASGTQREETAATPRMRRSYFLSRLFKEVIFGE
ASLVARDKRLSGRQLLFRRAAYASAVLLLAMVLTSWTATYFQNTAALAGAERRIDAYEQLVRGVPVRDVS
DADFLRILPALDNLAAVTTDFSRTRVWPVSLGLDQEGKVASRQREAYQRALNTLLLPRMLVQLQKEMTET
TDVNRTFDALKLYGMLGGLGPVNVDFASLEAEDMFTRLYPDEGRAAARKALIAHAGAMARGALPPIELDK
TLIAKAREIIRSQNIASRAYEILAEHRASRALPGWSPAGALGPLGEQAFERTSKAPLGESIPGLFSATGY
RTVVLPEISEAAREALDEQWVRGLPNPAGVTVDTVAQATLQLYFDKFDQRWSTLLTDIRVKPSQTISDAA
ETTRILAGKPGPVETIANSIAAATDLRGPSAEIASAAGDSLTDATTALSSAANAPDPFGPLREALKAPAG
QSPLPDQSKQTPRSGIGQLEPILQKVQEQLSRATTSTAEVAKVFDVDSQLTDANQDLLQQARKLPAPVDT
WMAGLAADVGSLAVKSARSRISDAWAAEGAGFCSNVVAGRYPFDRKSARDVAMSDFVRLFGPQGLFKTFF
KEKLEAFVDTSASPWGWKGTFGAASIPSAAIAQFENADKINRAFFPAGSKDPLITINVKPVSLTDAASAV
MLEIEGERVVYFHGPIQSKSISWPSAEASNTSRIAFQPGGWQQAMTENGDWSPFRLFDDANVTIQGDDLF
RAKFEQDGRAAEFDVQFGSVLNPFRLEALGAFSCPAQF
 
Nucleotide Sequence: 3477 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c494624-491148 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGAATCCCATAAGTTATTTCTATACGCTGCGTTCTTATGTGGAGGCCTATGCCGGCCTTCTCGGCCGCC
GCTTCATCTCGATCATATGGGTGGCGGCGATCTGCGTCGTCATCTGGTTCTACGGCTATCTCGCCGCCTA
TGGCGACTTTAAGCCGCTGGCGAGCGCCACGGCGCGGCTGACGCTGATCGGCGTCGTCATCGCCGCCTGG
CTCGCCTACCTCCTCTTCACCGTGATCCGCGACGGCCGCCGCGACAAGCAGCTCGTCGAAGGGATCGAGC
GTGACGCCGAGGCCGAAGCGGCGGCCAGCCAGCAGGCTGAGGTCGGCGAGATCCACAGCCGGCTGAAGGA
GGCGTTGCAGCTCCTGCGCCGCATCACCAAGCGACGCTTCGGCTATATTTACGAGCTGCCCTGGTACGTG
ATCTTCGGCGCGCCGGGCTCCGGCAAGACGACGGCGCTCACCAATTCCGGCCTCAAATTCCCGCTCGGCG
ACGCACTCGGCAGCAATTCGGTGAAGGGCGTCGGCGGCACGCGCAACTGCAATTGGTGGTTCACCGACGA
GGCCATACTCATTGATACCGCCGGCCGCTACACCACCCAGGACGATCTGAACGGCACCGCCAAGGCCGGC
TGGGAGGGCTTTCTCGGCCTCCTCAGAAAATACCGCCGGTCGCAGCCGATCAACGGCGCGCTGGTGACGC
TATCGATCGGCGACCTGCTGACACGCGATCCCGAAGCTCAGCGCGAGGAGATCAGAGCGATCCGCCAGAG
GCTGTCCGAGCTCGACGAACTCCTGCATGCACGCGTGCCGGTCTATCTGCTCCTGACCAAGGCCGATCTC
CTGACCGGCTTCGTCGAATTCTTCGACGGCTTCAACAAGAGCGACCGCGAACAGGTCTGGGGCACGACCT
TCGGGCTGGACGAAAGCTATAAGGCGGCCAACCTGCCGGAACGCTTCACAGAGGAATTCACCCTGCTGCA
GCAACGCGTCGACGCCATGCTGATCGAGCGCCTGCAGCAGGAGCCCAATCCGGAGCTGCGCGGCCGCATC
TTCCGCTTCCCCGCCGAGCTCGCCTCGCTGAAGGAGCGCCTGCATGAGGTGACGACGGAGCTTTGCTCGG
GCTCGAAACTGGTGGAGGCGCCGCTCCTGCGCGGCATCTATTTCGCCTCCGGCACCCAGAGGGAGGAGAC
CGCCGCCACGCCGCGCATGCGGCGCAGCTATTTCCTCTCGCGCCTCTTCAAGGAGGTGATCTTCGGCGAG
GCCTCGCTGGTTGCCCGCGACAAGCGGCTTTCCGGCCGACAGCTGCTCTTCCGCCGCGCGGCTTACGCCA
GCGCGGTCCTGCTGCTGGCCATGGTGCTGACCAGCTGGACGGCCACCTATTTCCAGAACACCGCGGCGCT
TGCGGGTGCGGAAAGACGCATCGACGCCTATGAGCAGCTGGTGCGCGGCGTGCCGGTGCGCGACGTCTCA
GATGCGGATTTCCTGCGCATTCTGCCGGCGCTCGATAATCTTGCTGCCGTCACTACCGATTTTTCGAGGA
CGCGCGTCTGGCCGGTGAGCCTCGGCCTCGATCAGGAAGGCAAGGTCGCGAGCCGCCAGCGCGAAGCCTA
TCAGCGGGCGCTGAACACGCTGCTCCTGCCCCGCATGCTGGTGCAGCTCCAGAAGGAGATGACCGAGACG
ACCGACGTCAACAGAACCTTCGACGCGCTGAAGCTCTACGGCATGCTCGGCGGGCTCGGCCCTGTGAATG
TGGATTTCGCCTCTTTGGAAGCGGAAGACATGTTCACCAGGCTCTATCCCGACGAAGGCCGGGCCGCTGC
GCGCAAGGCGCTGATCGCCCATGCGGGAGCCATGGCGCGCGGCGCGCTGCCGCCCATCGAGCTCGACAAG
ACGCTGATCGCCAAGGCACGCGAGATTATCCGCTCGCAGAACATCGCCAGCCGCGCCTATGAGATCCTGG
CGGAACACCGCGCTTCCCGCGCCCTTCCCGGCTGGAGTCCGGCCGGTGCGCTCGGTCCGCTCGGCGAACA
GGCATTCGAGCGGACCTCCAAGGCGCCGCTTGGCGAGAGCATCCCCGGCCTCTTTTCCGCGACCGGCTAC
CGGACCGTCGTTCTGCCGGAGATCAGCGAGGCCGCGCGCGAGGCACTCGACGAGCAGTGGGTGCGCGGCT
TACCCAATCCCGCCGGTGTCACGGTCGACACCGTCGCCCAGGCCACACTTCAGCTTTACTTCGACAAGTT
CGATCAACGCTGGTCGACCCTGTTGACCGATATCAGGGTCAAACCTTCGCAGACGATCAGCGACGCGGCT
GAGACCACTCGCATCCTCGCCGGCAAGCCCGGTCCCGTCGAGACGATCGCGAATTCGATCGCCGCGGCCA
CCGATCTGCGCGGCCCCAGCGCCGAGATCGCCTCGGCTGCCGGAGACAGTTTGACCGACGCAACCACGGC
GCTGAGCAGTGCCGCCAATGCGCCCGATCCCTTCGGCCCGCTGCGAGAGGCGTTGAAGGCGCCGGCCGGC
CAGTCGCCGCTCCCCGACCAATCGAAGCAGACGCCCCGCTCGGGGATCGGACAGCTGGAACCGATCCTGC
AGAAAGTACAGGAGCAGCTTTCGCGGGCGACGACCTCTACCGCTGAAGTGGCAAAAGTCTTCGACGTCGA
TAGCCAGTTGACGGACGCCAACCAGGACTTGCTGCAGCAAGCCCGGAAGTTGCCGGCGCCAGTCGATACA
TGGATGGCGGGGCTCGCCGCCGATGTCGGTTCGCTGGCGGTCAAATCCGCTCGTTCGCGCATCAGCGATG
CCTGGGCCGCGGAGGGTGCCGGCTTCTGCTCGAATGTCGTGGCCGGCCGTTATCCCTTCGATCGAAAATC
GGCGCGCGACGTGGCGATGAGCGACTTTGTCAGGCTGTTCGGACCCCAGGGGCTGTTCAAGACCTTCTTC
AAGGAAAAGCTTGAGGCCTTCGTCGATACCAGCGCTTCGCCATGGGGCTGGAAGGGCACCTTCGGGGCGG
CGAGCATTCCGAGCGCGGCGATCGCCCAGTTCGAGAATGCCGACAAGATCAACCGCGCCTTCTTCCCAGC
CGGCAGCAAGGACCCGTTGATCACCATCAACGTCAAGCCGGTGTCGCTGACCGATGCCGCCAGCGCCGTG
ATGCTGGAGATCGAGGGCGAACGCGTCGTTTATTTCCATGGACCGATTCAGTCGAAATCGATCAGCTGGC
CATCGGCGGAAGCCAGCAACACCTCGCGGATCGCCTTCCAGCCGGGCGGCTGGCAGCAGGCCATGACCGA
AAACGGCGACTGGTCGCCCTTCCGCCTCTTCGACGATGCCAATGTCACGATCCAAGGCGACGATCTTTTC
CGGGCGAAATTTGAGCAGGATGGCCGGGCGGCGGAGTTCGACGTGCAGTTCGGTTCGGTGCTCAATCCAT
TCCGGCTGGAGGCGCTCGGCGCCTTCTCATGCCCGGCGCAATTCTGA
 Primer design