SecReT6
Protein ID: 528837979
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00465
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]494624..496162 [-]
Producttype VI/VI secretion system outer membrane protein
NoteTssL
UniProt IDS5S8A9
KEGG IDrel:REMIM1_PF00465
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-55, Aligned region: 78..283
OmpA [PF00691], Evalue: 1.00E-12, Aligned region: 374..471
Protein Sequence: 512 a.a.     [Download]
>gi|528837979|ref|YP_008369059.1| type VI/VI secretion system outer membrane protein [Rhizobium etli bv. mimosae str. Mim1]
MKNEPASTWQSLPTIVELTEDGVKKKQSARKIAEMLDDVLDFPEGEKGTGPAAAPAKGGASVETLVKDFR
FGAEDVPTLVRSAAPLLNLAHGLRYTEEQPADIDELRTVAIAAVGRYERDLASARISPERARAAHYVVCA
TVDDVVLSKAWGVRAGWARSGLVSTFHMDVTGGERVFDLLDHFHQSPGANKDLLLLIYLCLSLAFEGRTR
VSARGALELARIRDSLYKTLLGQYGVFERELSPHWKGVSARHQPLRTAAALWTLLSVLMLILALGYLFFT
LSLNRASDGTFERLANLPPRETPSVLVKVPEPPREPQPVVVAQTPAPPPPPPQVKPPSRLDNLLAFLQPE
VEKKLVTLSDSNGRLLVRISNSGLFATGSAEVSEKFHDLLQRIGGALAAEKFRAVVVGYTDNVPIRTVQF
PSNWHLSEARAKAVGEILASFTGPGAILTEGRADSDPIAGNDTQEGREMNRRTEILVLTDPSERLSDAGL
KTPPIEAETPNAPAATAGGAPR
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c496162-494624 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGAAGAACGAACCCGCTTCCACCTGGCAAAGCCTGCCGACCATCGTCGAACTCACCGAGGATGGCGTGA
AGAAAAAGCAATCCGCCCGGAAGATTGCGGAGATGCTGGACGACGTTCTCGATTTTCCCGAAGGCGAGAA
GGGAACGGGACCAGCGGCAGCGCCTGCGAAGGGCGGAGCCTCCGTCGAAACACTCGTCAAGGATTTCCGC
TTCGGGGCCGAGGACGTGCCGACCCTGGTGCGCTCGGCCGCGCCGCTGCTCAACCTTGCCCATGGCCTGC
GCTACACCGAAGAGCAGCCCGCTGACATCGATGAACTCAGGACCGTGGCGATCGCAGCCGTCGGCCGCTA
CGAGCGGGATCTCGCGAGCGCGCGCATTAGCCCCGAGCGGGCGCGTGCGGCCCATTATGTCGTCTGCGCG
ACGGTCGACGACGTCGTGCTCAGCAAGGCTTGGGGCGTGCGCGCCGGATGGGCGCGTTCGGGCCTCGTGT
CCACCTTCCATATGGACGTGACCGGCGGCGAACGGGTGTTCGACCTGCTCGACCATTTCCACCAGAGCCC
CGGCGCCAACAAGGACCTGCTGCTCCTCATCTATCTCTGCCTGTCGCTCGCCTTCGAAGGCCGCACCCGC
GTTTCCGCGCGCGGCGCGCTGGAGCTCGCCCGCATCCGCGACAGTCTCTACAAGACGCTGCTCGGCCAGT
ACGGGGTCTTCGAACGGGAGCTTTCCCCGCATTGGAAGGGCGTTTCCGCCCGGCACCAGCCGCTGCGCAC
CGCCGCCGCCCTTTGGACGCTGCTTTCCGTCCTGATGCTGATCCTGGCTTTAGGCTACCTGTTCTTCACG
CTCTCGCTGAACCGCGCCTCCGACGGCACGTTCGAGCGCCTTGCCAACCTGCCGCCACGCGAGACGCCAA
GCGTGCTGGTCAAGGTTCCAGAGCCGCCGCGCGAACCTCAGCCTGTGGTCGTCGCGCAAACGCCGGCTCC
TCCTCCGCCACCGCCGCAGGTCAAGCCGCCGAGCCGGCTCGATAATCTGCTCGCCTTCCTCCAGCCGGAG
GTCGAGAAGAAGCTCGTCACGCTGTCGGATTCGAACGGCAGGCTGCTCGTGCGCATCAGCAATTCCGGCC
TGTTTGCCACCGGCAGCGCCGAGGTCAGCGAGAAGTTCCACGATCTCCTGCAGCGGATCGGCGGCGCGCT
AGCCGCGGAAAAATTCCGCGCCGTCGTCGTTGGCTATACGGACAATGTGCCGATCCGAACCGTTCAATTC
CCATCTAACTGGCACCTGTCAGAAGCCCGCGCCAAGGCGGTCGGCGAAATCCTGGCATCCTTCACCGGGC
CGGGGGCGATCCTGACCGAGGGACGGGCCGATAGCGATCCGATCGCCGGCAACGACACGCAGGAGGGCCG
GGAGATGAACCGCCGCACCGAGATCCTGGTGCTGACCGATCCGAGCGAACGTCTGAGTGACGCCGGCTTG
AAGACGCCGCCGATCGAGGCCGAAACACCGAATGCACCGGCTGCAACCGCGGGAGGCGCTCCGCGATGA
 Primer design