SecReT6
Protein ID: 528837980
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00466
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]496159..497499 [-]
Producttype VI secretion system-associated protein
NoteTssK
UniProt IDS5SFR9
KEGG IDrel:REMIM1_PF00466
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.70E-150, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|528837980|ref|YP_008369060.1| type VI secretion system-associated protein [Rhizobium etli bv. mimosae str. Mim1]
MRNENRVAWSEGMFLRVQHFQQADRWTERLVRTATHGLSPYPWGIAEIGIDRGALAIGQFALSNLRGVLP
DGTPFEAPVDADLPPPLDLDENTKNAIVYLALPARQPGKADVALNGGAQRNSVRLVASPYEAPDANVETD
FMAPIDVGRLSLRYLKTGDELAGYELIGLARIIEVRSDRAVILDPDYILPSLNCTAAGRLNELITELLGI
VRHRAEAIAERIGDPTIRGTAEVGDYLLLQILNRADPMLKHISANATRIHPIVFYEHCIQLAGELATFTT
ERKRASDFAPYRHDDLKATFAAVFDDLRASLSSVLEQAAVAIGLAERRHGVRIGTINDRTLLRDAGFVLA
VRAEMPAEDVRRKLPAQIKVGPVERIADLVNVALPGIPVRPLPVLPRQLPYRSGTIYFELDTKNPLWKQL
DTSGAIAVHLAGDFPGLEIELWALRE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c497499-496159 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGAGGAATGAGAACCGGGTGGCCTGGAGCGAGGGCATGTTCCTTCGCGTGCAGCATTTTCAGCAGGCGG
ACCGCTGGACCGAACGGCTCGTGCGCACCGCCACGCACGGCCTGTCGCCCTATCCCTGGGGAATAGCGGA
GATCGGCATCGACCGCGGCGCGCTGGCGATCGGCCAGTTCGCGCTGTCGAACCTGCGCGGCGTATTGCCC
GACGGCACGCCGTTCGAAGCGCCCGTCGATGCCGACCTGCCGCCGCCGCTCGATCTCGACGAGAACACCA
AGAATGCGATTGTCTATCTCGCACTTCCCGCGCGCCAGCCCGGAAAGGCTGATGTGGCGCTAAACGGCGG
CGCTCAGCGCAACAGCGTTCGCCTCGTGGCCTCGCCCTATGAGGCGCCTGACGCCAATGTCGAAACCGAC
TTCATGGCGCCGATCGACGTCGGCCGCCTCAGCCTGCGTTATCTCAAGACCGGCGACGAGCTTGCCGGCT
ATGAACTGATCGGACTTGCCCGCATCATCGAGGTGCGCTCCGACAGGGCTGTCATTCTCGACCCAGATTA
CATCCTGCCTAGCCTCAACTGCACGGCCGCCGGCCGGTTGAACGAATTGATCACCGAGCTTCTCGGCATC
GTGCGCCACCGCGCCGAAGCCATTGCCGAACGCATCGGCGACCCCACCATCCGCGGCACGGCGGAGGTCG
GCGACTACCTGCTCCTGCAAATCCTCAATCGCGCCGATCCGATGCTGAAGCATATCTCGGCCAATGCCAC
GCGCATCCATCCGATCGTCTTTTACGAGCACTGCATCCAGCTCGCCGGTGAGCTCGCCACCTTCACGACC
GAGCGCAAGCGGGCGAGCGATTTCGCCCCCTACCGGCATGACGATCTAAAGGCGACCTTCGCTGCTGTCT
TCGATGATCTAAGAGCCTCGCTTTCCTCCGTGCTCGAACAGGCGGCTGTGGCGATTGGGCTTGCCGAGCG
CCGGCATGGTGTCCGGATCGGTACGATCAACGACCGCACCCTGCTTCGCGATGCCGGCTTCGTGCTGGCC
GTCCGGGCAGAGATGCCGGCCGAGGACGTGCGCCGCAAGCTGCCGGCGCAGATTAAGGTCGGTCCGGTCG
AACGCATCGCCGATCTCGTCAACGTGGCGCTGCCGGGCATTCCCGTGCGGCCGCTGCCGGTGCTGCCGCG
CCAGCTCCCCTATCGCTCCGGCACCATCTACTTCGAACTCGACACCAAGAATCCGCTCTGGAAACAACTC
GACACTTCGGGCGCCATCGCGGTGCATCTCGCCGGCGATTTCCCCGGGCTCGAAATAGAATTGTGGGCCC
TTAGAGAATGA
 Primer design