SecReT6
Protein ID: 528837981
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00467
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]497489..498673 [-]
Producttype VI protein secretion system FHA domain-containing protein
NoteFha
UniProt IDS5SW95
KEGG IDrel:REMIM1_PF00467
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.60E-14, Aligned region: 29..95
Protein Sequence: 394 a.a.     [Download]
>gi|528837981|ref|YP_008369061.1| type VI protein secretion system FHA domain-containing protein [Rhizobium etli bv. mimosae str. Mim1]
MRLELREITSDVAMPAGRSKWFFERGRRTLGRAPDCDWRLPEDRRSISKLHCIIERDRDGFLLRDQSANG
SRVDGVTVHEGEIARLSDRSRLEMGGLAFSVHISGSSDQEIEDPDAGLMLSDEPLTISAILADIAPGGRT
ASGILGERIADDWTLPEQGGRKGAASSRNVEIGWSGPPETRSVTQLLPEDWNSDETDYGSHLEHGSATHV
SVPIAQRRPAAIEIVNDNDPRPEAEAFPTLTIGRPEAFADRLEPLLARLEEAVEGAYAIFDMNAPRSGPE
LDFLAGREEALLGRIETLLAQQLKLNVALEALVHAAGRLEPRIVEAQVETGAWGLPWRRDRNYWQAYRAE
FEKDGKSRSIQDVFRDAMSDAVNGRKAGPRPQDGQEGKDAHHEE
 
Nucleotide Sequence: 1185 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c498673-497489 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGCGGCTCGAACTGAGAGAGATCACCAGCGACGTGGCAATGCCGGCCGGACGATCGAAATGGTTCTTCG
AACGCGGCCGGCGCACGCTCGGCCGGGCGCCCGATTGCGACTGGCGGCTGCCGGAGGACCGGCGCTCGAT
TTCGAAGCTGCATTGCATCATTGAGCGCGACCGTGATGGCTTCCTGCTGCGCGACCAGAGCGCCAACGGC
TCCCGGGTCGATGGCGTCACCGTGCATGAAGGCGAGATCGCAAGACTTTCCGACCGGTCGCGGCTGGAGA
TGGGCGGGCTTGCCTTCTCAGTTCACATCTCAGGCAGTAGCGACCAGGAAATCGAAGATCCCGATGCCGG
TCTCATGCTCAGCGACGAACCTCTGACCATTTCCGCGATCCTCGCCGACATCGCCCCGGGCGGCCGGACC
GCAAGCGGCATTCTCGGCGAGCGCATCGCCGATGACTGGACACTGCCCGAACAGGGCGGCAGGAAAGGCG
CGGCTTCCTCCCGAAATGTCGAGATCGGCTGGAGCGGGCCTCCGGAGACCCGCTCGGTCACCCAGCTTCT
GCCGGAGGACTGGAATTCCGACGAGACCGATTACGGCAGCCACCTCGAACATGGTTCAGCCACCCACGTT
TCCGTGCCGATCGCGCAGCGCCGGCCAGCGGCGATCGAAATCGTCAACGACAATGATCCCCGACCCGAAG
CCGAGGCGTTTCCGACCCTGACGATCGGCCGGCCGGAGGCCTTTGCGGATCGTCTGGAGCCGCTGCTTGC
CCGGCTGGAAGAGGCAGTCGAGGGTGCCTATGCCATCTTCGACATGAACGCGCCGCGCTCCGGCCCGGAG
CTGGATTTCCTGGCCGGCCGGGAGGAGGCGCTTCTCGGACGCATCGAGACCCTGCTCGCGCAGCAACTCA
AACTCAATGTCGCCCTCGAGGCCCTTGTCCACGCGGCGGGACGGCTGGAGCCGCGCATCGTCGAGGCGCA
GGTCGAGACCGGCGCCTGGGGCCTGCCCTGGCGCCGCGACCGGAACTATTGGCAGGCCTACAGGGCAGAA
TTCGAAAAGGACGGCAAGAGCCGGTCGATCCAGGATGTTTTCCGCGACGCGATGTCAGATGCGGTGAACG
GCAGAAAGGCAGGGCCTCGTCCGCAAGACGGGCAGGAAGGAAAAGACGCGCATCATGAGGAATGA
 Primer design