SecReT6
Protein ID: 528837982
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00468
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]498684..499685 [-]
Producttype VI secretion system-associated protein
NoteTssG
UniProt IDS5S7X1
KEGG IDrel:REMIM1_PF00468
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-71, Aligned region: 36..310
Protein Sequence: 333 a.a.     [Download]
>gi|528837982|ref|YP_008369062.1| type VI secretion system-associated protein [Rhizobium etli bv. mimosae str. Mim1]
MDMQAASKPDALTDLLERDPGRFEPVTAFRVAQASVGEGRLDVASHVGVSPARLAVSGYKRKGGRATVRS
ALAGLVGALGSMPSAYNELIMREERNRSRALAGFFDLFGARMAELFADASEKYRIARRLRWGGTWASNAF
VTTLLSLTGFGTKRLVEKSGVDEELILRFSGFFAARNRNAVNLRAMLTEFSGLPVEIELFRGRWLTIPME
ERSRMGQPQGVQLGVNATAGAAIHDFSGGFRIVIGPLGYADYLSLAPGGSAITELFALARLYVGAALEFD
IQVILKKEDVPFCRLGQGGDPPRLGWNSWARVAPAAKDSGDAVIVERPPAEMR
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c499685-498684 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGGATATGCAAGCCGCCAGCAAGCCAGATGCGCTGACCGACCTGCTCGAACGCGATCCCGGCCGCTTCG
AACCGGTGACGGCTTTCCGCGTCGCGCAGGCGTCGGTCGGCGAAGGACGGCTTGACGTCGCCTCCCATGT
CGGCGTCTCGCCGGCGCGGCTTGCGGTCAGCGGATACAAGCGCAAGGGAGGCCGCGCTACCGTGCGCAGC
GCGCTTGCCGGCCTCGTCGGCGCCCTCGGTTCGATGCCTTCAGCCTATAACGAACTCATCATGCGCGAGG
AGCGCAACCGGTCGCGGGCGCTGGCGGGCTTCTTCGATCTCTTCGGTGCGCGCATGGCCGAACTTTTCGC
CGATGCCAGTGAGAAATACCGCATCGCCCGGCGGCTGCGCTGGGGCGGCACATGGGCGAGCAATGCCTTC
GTCACCACGCTGCTCTCGCTCACCGGCTTCGGCACGAAGCGCCTCGTCGAAAAGAGCGGCGTCGACGAGG
AGCTGATCCTGCGTTTTTCCGGCTTCTTCGCCGCACGCAACCGCAATGCCGTCAATCTGCGGGCGATGCT
GACCGAATTCAGCGGCCTGCCGGTGGAGATCGAATTGTTCCGCGGCCGCTGGCTCACCATCCCGATGGAG
GAGCGCAGCCGCATGGGCCAGCCGCAGGGCGTGCAACTCGGCGTTAATGCGACGGCGGGTGCTGCCATCC
ACGATTTCAGCGGCGGTTTTCGCATCGTCATCGGTCCGCTCGGCTACGCCGACTACCTCTCGCTGGCGCC
GGGCGGGTCGGCGATCACCGAACTCTTCGCCCTGGCACGGCTCTATGTCGGCGCAGCACTCGAATTCGAC
ATTCAGGTCATCCTGAAGAAGGAGGACGTTCCCTTCTGCCGGCTCGGCCAGGGGGGCGATCCACCGCGCC
TGGGCTGGAACAGCTGGGCGCGGGTCGCGCCGGCGGCGAAAGACAGCGGCGACGCGGTGATCGTCGAGCG
CCCGCCGGCCGAGATGCGGTGA
 Primer design