SecReT6
Protein ID: 528837983
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00469
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]499706..501487 [-]
Producttype VI secretion system-associated protein
NoteTssF
UniProt IDS5SXD1
KEGG IDrel:REMIM1_PF00469
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-195, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|528837983|ref|YP_008369063.1| type VI secretion system-associated protein [Rhizobium etli bv. mimosae str. Mim1]
MAEGFLHRYNEELLALRRRAARFADAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARVRQKLDDEFPE
LTDSLLETLYPHYLAPLPSMSIVKFRSSDTLASAQTVPRHTEILAETVRGEACRFRTTQDVKIAPIEITG
ATLSGQPINAPLSAYAGVAGCLRLSIRSLDARKPFGSLGVNRLRLHIPSPWQQAVAIYELLANHTLGIAL
ARHADDRSPVFLPARNLKPVGFEPEEAMLPYPAPSFTGYRLLTEFFALPRKFLFLDIDGLDAWKGETLEL
FIYLRESDAKLEREVSVRDFTLNATPVINLFRQVCEPVAIDGTRTEYRLMPDARRQKTREIYSIDRVLLT
GSRGQEEFCQPFFGRSQRAGTSATYWQAYRRFDEDDRTSDMDIAFVDRQRRSAGPVDAVASVDTLCLNRD
LPEQLPFGGGHPFLQLASGHEAVAGVEALIPPTPSVRMYDHDGRNWRLISHLVLNHLSLFDNGGAALKDI
LSLYAFRDSPETKQLVDALVRIKATNSTARLGSGGMVPGTEITLEFDPAAIDRPSAFLFGSLLDRFFSLY
TSVNSFTRLTVGMKGQSRPIAQWPARAAERPLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c501487-499706 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGGCTGAGGGCTTCCTCCACCGTTATAATGAGGAATTGCTGGCGCTGCGCCGCCGGGCCGCGCGCTTTG
CCGATGCCTTCCCGAAGATCGCCGGCCGCCTGCGCATGACCGGCGACGTCGCCGACGACCCGCATGTGGA
GCGGCTGATCCAGAGCTTCGCCTATTCGGCCGCGCGCGTTCGCCAGAAGCTCGACGACGAGTTCCCGGAG
CTGACCGACAGTCTGCTCGAAACGCTCTATCCGCATTACCTCGCGCCCCTTCCATCCATGAGCATCGTGA
AGTTCCGGTCGAGCGATACGCTGGCCTCGGCGCAGACCGTGCCGCGCCACACCGAGATCCTGGCCGAAAC
GGTGCGCGGCGAAGCCTGCCGCTTCCGCACGACGCAGGATGTGAAAATCGCGCCGATCGAAATTACGGGC
GCCACCCTTTCCGGCCAGCCGATCAATGCACCGCTTTCGGCCTATGCCGGCGTTGCCGGCTGCCTCAGGC
TCTCCATCCGCAGCCTCGATGCCCGCAAGCCCTTCGGAAGCCTCGGCGTAAACCGGCTGCGCCTGCACAT
TCCCTCCCCCTGGCAGCAGGCCGTGGCGATCTACGAGCTGCTGGCCAATCACACGCTCGGCATCGCGCTT
GCCAGGCATGCGGACGATCGTTCGCCGGTCTTCCTGCCGGCCCGGAATCTCAAGCCTGTCGGCTTCGAGC
CCGAAGAGGCGATGCTGCCCTATCCGGCGCCGAGCTTCACCGGCTACCGGCTGCTCACCGAATTCTTCGC
CCTGCCCAGAAAGTTTCTGTTTCTCGACATCGATGGGCTCGATGCCTGGAAGGGCGAGACGCTGGAGCTC
TTCATCTATCTCAGGGAGAGTGACGCCAAGCTGGAGCGGGAGGTGTCGGTTCGCGATTTCACGCTCAACG
CCACGCCCGTCATCAATCTCTTCCGCCAGGTCTGCGAACCGGTCGCCATCGACGGCACCCGCACTGAATA
TCGCCTCATGCCCGATGCGCGGCGCCAGAAGACCCGCGAGATCTATTCGATCGACCGCGTGCTGCTGACC
GGATCACGCGGCCAGGAGGAATTCTGCCAGCCCTTCTTCGGCCGGTCGCAGCGGGCGGGCACGAGCGCGA
CCTACTGGCAGGCCTATCGCCGCTTCGACGAGGATGACAGGACCAGCGACATGGACATCGCCTTCGTCGA
CAGGCAGCGCCGCTCCGCAGGTCCCGTCGATGCGGTCGCGAGCGTCGATACGCTCTGCCTCAACCGCGAC
CTGCCGGAACAGCTTCCCTTCGGCGGCGGCCATCCCTTCCTGCAGCTTGCCTCCGGCCATGAGGCGGTGG
CCGGCGTCGAGGCGCTGATCCCGCCGACGCCTTCGGTGCGAATGTATGATCACGATGGCCGGAACTGGCG
GCTGATCTCGCATCTCGTCCTCAACCATCTCTCGCTCTTCGACAATGGCGGCGCGGCGCTGAAAGATATC
CTGTCGCTCTACGCCTTCCGCGACAGCCCCGAGACCAAGCAATTGGTCGACGCGCTGGTGCGGATCAAGG
CCACCAATTCGACGGCCCGTCTCGGGAGCGGCGGCATGGTGCCCGGCACCGAGATCACGCTGGAATTCGA
TCCGGCCGCCATCGACCGGCCCTCGGCCTTCCTGTTCGGCAGCCTGCTCGACCGCTTCTTCAGCCTCTAC
ACCTCGGTCAACAGCTTCACCCGGCTCACCGTCGGCATGAAGGGTCAGTCGAGACCGATCGCCCAATGGC
CGGCGCGCGCCGCCGAGCGCCCGCTTCTTTGA
 Primer design