SecReT6
Protein ID: 528837984
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00470
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]501480..501989 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDS5S8B4
KEGG IDrel:REMIM1_PF00470
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-18, Aligned region: 43..144
Protein Sequence: 169 a.a.     [Download]
>gi|528837984|ref|YP_008369064.1| type VI secretion system lysozyme-related protein [Rhizobium etli bv. mimosae str. Mim1]
MADPLERYRQRDRVLARSILDRLIDEAPDRAADPPMNFVDQVREMREAIRRDLEALLNTRRCPTTPPAVL
AELKDALVSYGVDGVVSANLMTDEAKLRLAAAIERRIALFETRLSDVRVTILKSRTITERALRLRIQATF
RLHEGMPPISFESTIDPSTQRFLVEAAHG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c501989-501480 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGGCTGATCCGCTCGAACGCTACCGGCAGCGCGACCGCGTCCTGGCCCGCTCGATCCTCGACAGGCTGA
TCGACGAGGCCCCGGATCGCGCTGCCGATCCGCCGATGAACTTCGTCGATCAGGTTCGCGAGATGCGCGA
GGCGATCCGCCGCGATCTCGAGGCGCTGCTCAACACGCGCCGCTGCCCGACCACGCCGCCGGCCGTCCTT
GCCGAACTGAAGGATGCTCTGGTGAGCTACGGCGTCGACGGCGTCGTCTCGGCCAATCTGATGACCGACG
AAGCGAAGCTCAGGCTGGCGGCCGCAATCGAGCGGCGGATCGCGCTCTTCGAAACGCGGCTTTCCGATGT
CAGGGTGACGATCCTGAAAAGCCGGACGATAACGGAGCGGGCGCTGCGCCTGCGCATCCAGGCGACCTTC
CGCCTGCATGAAGGCATGCCGCCGATCAGCTTCGAATCGACAATCGACCCTTCCACCCAGCGTTTCCTGG
TGGAGGCCGCGCATGGCTGA
 Primer design