SecReT6
Protein ID: 528837985
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00471
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]501982..502812 [-]
Producttype VI secretion system ImpE family protein
NoteTagJ
UniProt IDS5SFS6
KEGG IDrel:REMIM1_PF00471
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.70E-36, Aligned region: 141..262
TPR_19 [PF14559], Evalue: 0.001, Aligned region: 12..66
TPR_19 [PF14559], Evalue: 0.001, Aligned region: 117..130
Protein Sequence: 276 a.a.     [Download]
>gi|528837985|ref|YP_008369065.1| type VI secretion system ImpE family protein [Rhizobium etli bv. mimosae str. Mim1]
MTLSATIAQSLSDNALDEALEEVKAHLKAKPSDQEARHLYIDLLVLAGEYERADNQCSLAATLSPDATMG
FALLRSELRAMAARDAWFASGGVPEFPQGPSELDKLAVRLGIAHRDGDAEAAKTALAALEDLRGETELIW
NGKAVSDFRDLDDRTPHALEVIMTGGGYLWIDFAKIAALSIEPIARPRDLAFRRAELTLIDGAAASVLLP
AVYHGTGEDAALRLGRETEWVEEASGITTGRGQRCFLAGDELVSFHDTQSLEIVPASSAGRQAAHG
 
Nucleotide Sequence: 831 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c502812-501982 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGACGCTGTCCGCCACCATCGCCCAATCGCTCAGCGACAACGCTCTCGACGAGGCGCTCGAAGAGGTCA
AGGCACATCTGAAAGCCAAGCCCTCCGATCAGGAGGCACGGCACCTCTATATCGACCTTCTGGTCCTTGC
CGGGGAATATGAGCGGGCGGACAATCAGTGCAGCCTTGCCGCTACCCTCTCCCCCGACGCGACGATGGGC
TTTGCCCTGTTGCGCAGCGAACTTCGGGCGATGGCGGCACGCGACGCCTGGTTTGCGAGCGGCGGCGTGC
CGGAGTTTCCGCAGGGACCGAGCGAACTCGACAAGCTCGCCGTCCGTCTCGGCATCGCCCATCGTGATGG
CGATGCGGAGGCAGCGAAAACGGCGCTCGCTGCGCTCGAAGACCTCAGGGGCGAGACCGAGCTGATCTGG
AACGGTAAGGCGGTTTCCGATTTCCGCGACCTCGACGACCGCACACCGCACGCTCTCGAAGTCATCATGA
CCGGCGGCGGCTATCTCTGGATCGACTTCGCCAAGATCGCGGCGCTGTCGATCGAGCCGATTGCCCGGCC
GCGTGATCTCGCCTTCCGCCGCGCGGAATTGACGCTGATCGACGGCGCAGCCGCATCGGTGCTTCTGCCG
GCGGTCTATCATGGCACCGGCGAGGACGCGGCGCTGAGACTCGGCCGAGAAACCGAATGGGTCGAGGAAG
CGAGCGGCATCACCACCGGCCGCGGCCAGCGCTGCTTCCTCGCCGGCGACGAACTCGTCTCCTTCCATGA
CACCCAAAGTCTGGAGATCGTCCCGGCAAGCTCTGCCGGCAGGCAGGCCGCGCATGGCTGA
 Primer design