SecReT6
Protein ID: 528837986
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00472
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]502809..504197 [-]
Producttype VI secretion system-associated protein
NoteTssC
UniProt IDS5SWA0
KEGG IDrel:REMIM1_PF00472
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-154, Aligned region: 12..443
Protein Sequence: 462 a.a.     [Download]
>gi|528837986|ref|YP_008369066.1| type VI secretion system-associated protein [Rhizobium etli bv. mimosae str. Mim1]
MGSSTEWRRRADQLITLIDEALNRQVNAILHHPDFQAMEARWRGLAMLVREASRSGEVKVKLLSVSWREL
ARSMERASDFDQSHLFELIYSREFGMPGGEPFGLLVGDYHLSPADPADGDPVSTLSQIGMVAAAAFCPFV
AGAAPAAIGLEDFHELNRVNDFSWLATEADRIRWNGLRAREDSRFLGLAAPRILMRSPLTPHARDRNDGF
PFRESIAADGSSLLWGNAAFAFATVVIRNFINSGWFADIRGVTQDAVDGGLLSAAELPPYDFGTESNGLS
AQAPVEIHLTSSQEQQLCELGIIPAATTYLSSSAIFNSNQSLHAPPHYSNEHARQNARLAAMLQYVLCAS
RFSHYLKVIMRDEIGQLSDAISIERKLMDWLTAYTLGNDDADIALRTRFPLRSAGISVAEIPGKPGSFSC
TVRLQPHFQLDDVATSFHLIAETATTGQILSRPVAMPERMSA
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c504197-502809 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGGGTTCCAGCACTGAATGGCGGCGCCGGGCGGATCAGCTGATTACGCTGATCGACGAAGCGCTGAACA
GGCAAGTCAACGCCATCCTCCACCATCCCGATTTTCAGGCGATGGAGGCGAGATGGCGCGGCCTTGCCAT
GCTCGTGCGCGAGGCAAGCCGCAGCGGCGAAGTCAAGGTCAAGCTGCTCAGCGTCAGCTGGCGCGAACTG
GCGCGCAGCATGGAGCGCGCCAGCGATTTCGACCAGAGCCATCTGTTCGAACTGATCTACAGCCGCGAAT
TCGGCATGCCGGGCGGCGAGCCCTTCGGCCTCTTGGTCGGCGACTATCATCTGTCTCCGGCCGATCCCGC
CGACGGCGATCCGGTCAGCACGCTGTCGCAGATCGGCATGGTGGCCGCCGCCGCCTTCTGCCCCTTCGTC
GCGGGCGCTGCGCCGGCTGCGATCGGGCTTGAGGATTTTCACGAACTGAACCGGGTGAATGACTTCTCCT
GGCTTGCCACCGAGGCGGACCGCATCCGCTGGAACGGTCTTCGCGCCCGTGAGGATTCGCGTTTCCTCGG
GCTTGCCGCGCCGCGCATCCTGATGCGCTCGCCGCTCACACCGCATGCGCGCGATCGCAACGACGGCTTT
CCCTTCCGCGAAAGCATTGCCGCCGACGGCAGTTCGCTGCTCTGGGGCAATGCCGCCTTTGCCTTCGCGA
CCGTCGTCATCAGGAATTTCATCAATTCCGGCTGGTTCGCCGATATCCGCGGCGTCACGCAGGATGCCGT
CGACGGCGGCTTGCTGAGTGCGGCCGAATTGCCGCCATACGATTTCGGCACCGAAAGCAACGGCCTGTCA
GCTCAGGCGCCTGTCGAAATCCACCTGACCAGCAGCCAGGAGCAGCAACTCTGCGAGCTCGGCATTATCC
CGGCGGCGACCACCTATCTCTCGTCTTCGGCGATTTTCAATTCCAACCAGTCGCTGCACGCGCCGCCGCA
TTATTCCAACGAACATGCGCGCCAGAACGCGCGGCTCGCCGCCATGCTGCAATATGTGCTCTGCGCCTCG
CGCTTCTCGCATTATCTCAAGGTCATCATGCGCGACGAGATCGGCCAGCTCTCCGATGCGATCTCGATCG
AGCGCAAGCTCATGGACTGGCTGACCGCCTATACGCTCGGCAACGACGACGCCGATATCGCGCTGCGCAC
CCGCTTTCCGCTGCGCTCCGCAGGCATCAGCGTCGCCGAAATTCCGGGCAAGCCCGGCAGCTTCTCCTGC
ACCGTCCGCCTGCAGCCGCATTTCCAGCTCGATGACGTCGCCACGAGCTTCCACCTGATCGCCGAGACCG
CGACCACGGGCCAGATCCTGAGCCGGCCGGTCGCCATGCCCGAGAGGATGTCCGCATGA
 Primer design