SecReT6
Protein ID: 528837987
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00473
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]504268..505749 [-]
Producttype VI secretion system-associated protein
NoteTssC
UniProt IDS5S7X5
KEGG IDrel:REMIM1_PF00473
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-192, Aligned region: 64..490
Protein Sequence: 493 a.a.     [Download]
>gi|528837987|ref|YP_008369067.1| type VI secretion system-associated protein [Rhizobium etli bv. mimosae str. Mim1]
MTAETQLQTKEEVGFAPDENLLSKVVAATRQTEPDRAQDLLRTLTDQALKGTVTYDRNLTITLNNAIAEI
DKAISTQLAAIMQSPEFTKLEGAWRGLHYLVKNTETSANLKIRVLNASKRDVAKDLAKAVEFDQSRLFKS
VYEDEFGTPGGEPMGALIGDYEFDNSFDDVQLLQGVSMIAAAAFAPFISAASPRMFGFEDFRELAKPRDL
EKIFETVEYAKWRSLRDSDDSRFVTLAMPRVLARMPYGPKTSPIEEFNFDETGGSKTGELPHGSYCWMNA
AYVMGTRLTEAFAKNGWCTAIRGAENGGKVEGLPMHIFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLP
LCHYKNTDYAVFFGAQTAHKPKLYDRPEATANAAVSARLPYMMATSRFAHYLKVMGRDKIGSFMEAEDCE
AWLNRWISNYVNANDDAGEESRAKYPLREAKVTVQEIPGRPGAYNAVAWMRPWLQMEELTTSLRMVARIP
SKN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c505749-504268 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGACCGCCGAAACGCAATTGCAGACAAAGGAAGAGGTAGGCTTCGCACCCGATGAGAACCTGCTCTCGA
AGGTCGTTGCGGCAACCCGCCAGACCGAGCCCGACCGTGCGCAGGATCTTCTACGCACCCTCACCGATCA
AGCCCTGAAGGGCACCGTCACCTATGATCGCAATCTGACGATCACCTTGAACAACGCCATTGCTGAGATC
GACAAGGCGATCTCGACCCAGCTCGCGGCGATCATGCAGTCGCCGGAGTTCACCAAGCTCGAAGGCGCCT
GGCGCGGCCTGCACTATCTCGTCAAGAACACCGAGACCAGCGCCAACCTGAAGATCCGCGTGCTCAACGC
CTCCAAGCGCGACGTCGCCAAGGATCTCGCCAAGGCCGTCGAGTTCGACCAGTCCAGGCTCTTCAAGTCG
GTCTACGAAGACGAATTCGGCACACCCGGCGGCGAACCGATGGGCGCGCTGATCGGCGATTATGAATTCG
ACAATTCCTTCGACGACGTCCAGCTTCTGCAAGGCGTCTCGATGATCGCCGCCGCCGCCTTCGCACCGTT
CATCTCGGCGGCGAGCCCGCGCATGTTCGGCTTCGAGGATTTCCGCGAGCTGGCAAAACCGCGCGATCTG
GAAAAGATCTTCGAGACGGTGGAATACGCCAAGTGGCGCAGCCTGCGCGACAGCGATGATTCCCGCTTCG
TGACGCTCGCCATGCCGCGCGTGCTCGCCCGCATGCCTTACGGTCCGAAGACCAGCCCGATCGAGGAATT
CAACTTCGACGAAACCGGCGGCTCCAAAACCGGCGAGCTGCCGCACGGCTCCTATTGCTGGATGAACGCG
GCCTATGTGATGGGCACGCGCCTGACCGAAGCCTTCGCCAAGAACGGCTGGTGCACCGCCATTCGCGGCG
CGGAAAACGGTGGCAAGGTCGAAGGCCTGCCGATGCATATCTTCTCCAGCGACGACGGCGATCTCGATCT
GAAATGCCCGACGGAAGTCGGCATCACCGATCGCCGCGATGCCGAACTCGGAAAGCTCGGCTTCCTGCCG
CTCTGCCACTACAAGAATACCGACTACGCGGTGTTCTTCGGGGCGCAGACGGCCCACAAGCCGAAGCTCT
ACGACCGGCCCGAGGCGACCGCCAATGCCGCCGTTTCCGCCCGCCTGCCCTACATGATGGCGACCTCGCG
CTTTGCCCATTACCTCAAGGTCATGGGCCGCGATAAGATCGGCTCCTTCATGGAAGCGGAGGATTGCGAG
GCCTGGCTCAATCGCTGGATCTCCAACTACGTCAACGCCAACGACGACGCCGGCGAGGAGTCGCGGGCGA
AATATCCGCTGCGCGAGGCAAAGGTCACCGTCCAGGAAATCCCCGGTAGGCCGGGCGCCTACAACGCGGT
AGCCTGGATGCGTCCCTGGTTGCAGATGGAGGAATTGACCACCTCGCTGCGCATGGTCGCCCGGATTCCT
TCGAAGAACTGA
 Primer design