SecReT6
Protein ID: 528837988
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00474
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]505879..506424 [-]
Producttype VI secretion system-associated protein
NoteTssB
UniProt IDS5SXD4
KEGG IDrel:REMIM1_PF00474
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-60, Aligned region: 15..169
Protein Sequence: 181 a.a.     [Download]
>gi|528837988|ref|YP_008369068.1| type VI secretion system-associated protein [Rhizobium etli bv. mimosae str. Mim1]
MRRRRASMASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQPLKAFGERKFVQID
RDNFDDVMRRMTPGLTLSVENTLEKDGTELPVSLKFESMADFEPGAVVDQVPALKALLNARNQLRDLMSK
ADRSEELERLLEEILQNKADLSQLVAQLGGGKAGEAKDVLN
 
Nucleotide Sequence: 546 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c506424-505879 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGAGACGAAGGAGAGCCTCGATGGCAAGTGTACATGAAAAACTGGAACGGGTTCGCAAGCCGCGGGTCC
ATATCAAATATGAAGTCGAAACCGAAGGCGCGATGGTGGTGAAGGAGCTGCCTTTCGTCGTCGGCGTGCT
CGGCGACTTCTCCGGCAATCCGACACAGCCTCTCAAGGCTTTCGGCGAGCGCAAGTTCGTGCAGATCGAC
CGCGACAATTTCGACGACGTCATGCGCCGGATGACGCCGGGCCTCACGCTTTCGGTCGAGAACACTCTCG
AGAAAGACGGAACGGAGCTTCCGGTTTCACTGAAATTCGAAAGCATGGCCGACTTCGAACCGGGCGCGGT
CGTCGATCAGGTGCCGGCGCTGAAGGCGCTGCTCAACGCCCGCAACCAGCTGCGCGACCTGATGAGCAAG
GCGGACCGCTCCGAGGAGCTCGAGCGCCTGCTCGAGGAGATCCTGCAGAACAAGGCCGATCTCTCGCAGC
TGGTGGCTCAGCTTGGCGGCGGCAAGGCCGGCGAGGCGAAGGACGTTCTGAACTGA
 Primer design