SecReT6
Protein ID: 528837989
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00475
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]506486..507550 [-]
Producttype VI secretion system-associated ImpA-related domain-containing protein
NoteTssA
UniProt IDS5S8B7
KEGG IDrel:REMIM1_PF00475
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-18, Aligned region: 59..116
Protein Sequence: 354 a.a.     [Download]
>gi|528837989|ref|YP_008369069.1| type VI secretion system-associated ImpA-related domain-containing protein [Rhizobium etli bv. mimosae str. Mim1]
MNVREIVDPLAQNYPCGENVRNNTSLREIYYRIKDARNAARTAERSISPGDVITLAPAWHDVSNLGLQIL
SSRSKDIEVLAWLAEAQLRLRGFSGLRDVYVATASLLDKHFDALHSIGDSDFEERFAPFAGLNGVGGEGT
LIQAIRLTSLIPDGKFAQFSLWDFQLSQRPNEAERRKELQQAAAEAGVARMSAHLNVVTECIAAFDRMIE
ILDKHCGDQAPPSSNTRNALQEAASAIRMLAGIEAPSVISETPASQGLEPLPAADIGESETVRMRPVSAE
MIRSREEAFELLAAVGRYFRRTEPHSPISMSIETLVRRGRMDFSELLAELLPEQHARNAVLTAAGIQPVT
DKGG
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|528837521|ref|NC_021911.1|:c507550-506486 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
GTGAATGTCCGCGAAATCGTAGATCCACTTGCACAAAATTATCCGTGCGGAGAAAACGTCCGGAATAACA
CTTCGTTGCGCGAAATATACTATAGAATTAAGGACGCCAGAAACGCCGCACGTACAGCCGAACGTAGTAT
TTCACCGGGTGACGTTATTACGCTTGCACCCGCTTGGCACGATGTTAGCAATCTTGGATTGCAAATTCTT
TCTTCCAGGAGCAAGGACATAGAAGTATTGGCCTGGCTTGCCGAAGCGCAGCTGCGGCTGCGCGGCTTCT
CAGGATTGCGCGACGTCTATGTTGCAACCGCGTCGCTTCTAGACAAGCATTTCGACGCTTTGCACTCGAT
CGGAGACAGCGATTTCGAGGAACGGTTCGCTCCATTTGCAGGTCTTAACGGCGTGGGCGGCGAAGGAACG
CTTATCCAGGCTATTCGTTTGACATCGTTGATCCCGGACGGAAAATTCGCACAGTTTTCGCTCTGGGATT
TCCAGCTTTCGCAGCGGCCGAACGAAGCCGAGCGGCGCAAGGAATTGCAGCAGGCGGCGGCAGAAGCCGG
TGTCGCACGGATGTCGGCCCATCTCAACGTGGTGACAGAGTGCATCGCCGCCTTCGACCGCATGATCGAA
ATACTTGACAAACACTGTGGGGATCAGGCGCCACCTAGTTCGAATACACGCAATGCTTTGCAGGAAGCGG
CCTCTGCAATCCGGATGCTCGCCGGCATCGAGGCTCCCTCGGTCATATCAGAAACCCCTGCTTCGCAAGG
CTTAGAGCCGCTGCCGGCAGCCGATATCGGCGAGTCCGAGACCGTCCGCATGCGGCCCGTCAGCGCCGAG
ATGATTCGGTCACGCGAAGAGGCTTTCGAACTGCTCGCTGCCGTTGGGCGCTATTTCCGCCGCACCGAAC
CCCATTCACCGATTTCTATGTCGATCGAGACCCTGGTGCGCCGCGGCCGCATGGATTTTTCCGAGCTTCT
TGCCGAGCTCCTGCCTGAGCAGCACGCGCGCAATGCGGTGCTGACGGCGGCCGGCATACAGCCCGTAACC
GACAAGGGAGGCTAG
 Primer design