SecReT6
Protein ID: 528837990
SecReT6 ID836
T6SS typei5
Gene symbolclpV1
Locus tagREMIM1_PF00476
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]507886..510540 [+]
Producttype VI secretion system ATPase protein ClpV1
NoteTssH
UniProt IDS5SFT0
KEGG IDrel:REMIM1_PF00476
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-41, Aligned region: 178..255
AAA_2 [PF07724], Evalue: 4.20E-41, Aligned region: 580..744
AAA [PF00004], Evalue: 5.30E-21, Aligned region: 77..113
AAA [PF00004], Evalue: 5.30E-21, Aligned region: 179..291
AAA [PF00004], Evalue: 5.30E-21, Aligned region: 585..711
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 179..197
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 381..411
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 584..705
ClpB_D2-small [PF10431], Evalue: 1.00E-11, Aligned region: 752..828
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 22..85
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 156..200
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 222..257
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 317..389
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 553..603
AAA_16 [PF13191], Evalue: 4.70E-10, Aligned region: 649..677
Sigma54_activat [PF00158], Evalue: 4.40E-09, Aligned region: 157..195
Sigma54_activat [PF00158], Evalue: 4.40E-09, Aligned region: 575..703
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 179..260
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 301..373
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 583..664
Zeta_toxin [PF06414], Evalue: 4.00E-06, Aligned region: 174..204
Zeta_toxin [PF06414], Evalue: 4.00E-06, Aligned region: 578..624
IstB_IS21 [PF01695], Evalue: 6.60E-06, Aligned region: 166..221
IstB_IS21 [PF01695], Evalue: 6.60E-06, Aligned region: 584..602
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 177..203
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 579..612
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 176..201
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 582..606
NACHT [PF05729], Evalue: 2.60E-05, Aligned region: 179..207
NACHT [PF05729], Evalue: 2.60E-05, Aligned region: 584..667
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 144..173
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 179..221
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 441..457
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 583..619
Arch_ATPase [PF01637], Evalue: 3.30E-05, Aligned region: 158..193
Arch_ATPase [PF01637], Evalue: 3.30E-05, Aligned region: 232..336
Arch_ATPase [PF01637], Evalue: 3.30E-05, Aligned region: 580..596
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 179..199
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 585..616
ResIII [PF04851], Evalue: 0.0018, Aligned region: 164..201
ResIII [PF04851], Evalue: 0.0018, Aligned region: 249..260
ResIII [PF04851], Evalue: 0.0018, Aligned region: 556..605
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 180..441
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 583..626
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 179..198
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 581..605
PhoH [PF02562], Evalue: 0.0048, Aligned region: 164..199
PhoH [PF02562], Evalue: 0.0048, Aligned region: 583..602
Torsin [PF06309], Evalue: 0.0073, Aligned region: 181..196
Torsin [PF06309], Evalue: 0.0073, Aligned region: 540..607
Protein Sequence: 884 a.a.     [Download]
>gi|528837990|ref|YP_008369070.1| type VI secretion system ATPase protein ClpV1 [Rhizobium etli bv. mimosae str. Mim1]
MDVAHWLRSLLDIAAFSAVFEELKLSSEMLRTELDAAIADIPREAGAALALSANLLALGRESFLVASLQC
GRNVVLLADLLAALTGDSALRVVVRGIAPSIRNLDRAMLDKLLEKAAAGPSDQLSVPTATSAGNEFLRLY
THDMTADARAGRIDPVIGRDAELRQLIDILTRRRQNNPILVGEAGVGKTAVAEALALEIAAGNIPARLKD
VKLLLLDLSLLQAGAGVKGEFERRLHGVVDAVKTSPEPIILFIDEAHGLIGAGGQAGQGDAANILKPALA
RGELRTIAATTWSEYKRFIEKDAALTRRFQTVHVREPDEEAAIRMLRGVAQSLKIHHKVRIRDEAIVAAV
RLSARYLPDRQLPDKAISLIDTAAAAVALARQTRPEALKQLTDERDLLETEANWLAREPETPEKAARLGE
IAVKQQEIVAQIEALRSQFEEENRLVREADRLEDFFSPDDAIVPLAPADSGDGTNVAPFPPQAMTTEAAR
AAFAVTERTLAAVADQTALLPRVVDKDVVASIVARWTGIPVGKLLADQIETVKTLDARLKERVLGQDAAI
ERIASAMRAARAGLSDPRRPPAVFLLVGMSGTGKTETALSLADMLYGGSRYLTTINMSEFKEEHKISMLL
GSPPGYVGYGEGGVLTEAVRRRPYGVLLLDEIDKAHPGVQEIFYQVFDKGTLRDGEGRDIDFKNTTIVMT
ANTGSEMIAALAADPETMPEAEALEAMLLPELQKHFKPAFLGRTTVLPFMPLGPETLSGIVDIQIGRIRE
RVGASYGAALSLSPQAREALISRGRTSEMGARAIEVMIARDLLPVLSTYFLDAVAAGKKIKGIAINYDGH
RFGLDAEEAAAQEFGTPGESRLSDEVAPGRKRTRGAGRRKATTP
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|528837521|ref|NC_021911.1|:507886-510540 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
GTGGATGTCGCGCATTGGCTTCGCTCCCTTCTTGATATTGCGGCGTTTTCCGCCGTTTTCGAAGAGCTCA
AGCTCTCCTCGGAAATGCTGAGAACGGAGCTGGACGCGGCGATCGCCGACATTCCGCGGGAGGCCGGCGC
CGCACTGGCGCTCTCCGCCAACCTGCTGGCCCTTGGCCGGGAATCCTTCCTGGTTGCATCGCTGCAGTGC
GGCCGTAATGTCGTGCTACTGGCCGACCTGCTCGCAGCCCTGACCGGCGATTCGGCATTGCGGGTGGTTG
TGCGCGGCATTGCTCCCTCGATACGCAATCTCGACCGGGCAATGCTCGACAAATTGCTGGAGAAGGCGGC
CGCTGGCCCGTCGGACCAGCTTTCGGTGCCCACCGCGACATCGGCAGGCAATGAATTTCTGCGGCTCTAC
ACGCACGACATGACGGCCGACGCCCGCGCGGGCCGCATCGATCCTGTTATCGGCCGCGACGCTGAGTTGC
GGCAGCTGATCGATATACTGACGCGCCGTCGGCAGAACAACCCGATCCTGGTCGGCGAGGCTGGTGTCGG
CAAGACTGCTGTGGCCGAAGCGCTCGCATTGGAGATCGCCGCCGGCAATATTCCGGCCCGGCTGAAGGAT
GTGAAGCTGCTGCTGCTGGATCTGAGCCTGCTGCAGGCCGGCGCCGGCGTCAAAGGCGAGTTCGAACGGC
GCCTGCATGGCGTGGTCGACGCGGTAAAGACGTCACCGGAACCGATCATCCTGTTCATTGACGAGGCGCA
CGGGCTGATCGGCGCCGGCGGACAGGCAGGGCAAGGCGATGCCGCAAACATCCTGAAACCGGCTTTGGCG
CGCGGAGAACTCAGGACTATCGCGGCAACGACCTGGAGCGAATATAAACGCTTCATCGAGAAAGATGCGG
CCCTGACCCGCCGCTTCCAGACCGTGCATGTCCGCGAGCCGGACGAAGAGGCTGCAATCCGGATGCTGCG
CGGCGTGGCGCAAAGCCTGAAAATCCATCACAAGGTGCGCATTCGCGACGAGGCGATCGTCGCCGCCGTC
CGCCTTTCGGCGCGATACCTGCCGGACCGGCAGCTTCCCGATAAGGCGATCAGCCTGATCGACACGGCTG
CCGCCGCCGTGGCGCTGGCTCGCCAGACGAGGCCGGAGGCTTTGAAACAGCTTACCGATGAACGCGATCT
CTTGGAAACCGAGGCTAACTGGCTTGCGCGAGAACCCGAGACACCGGAAAAGGCCGCCCGGCTTGGCGAA
ATCGCCGTCAAGCAGCAGGAGATCGTTGCGCAGATCGAAGCGCTCCGGTCGCAGTTCGAGGAAGAAAATC
GGCTGGTCCGCGAGGCCGACCGGCTGGAGGATTTCTTCTCGCCGGACGATGCCATCGTCCCGTTGGCGCC
GGCGGACAGTGGCGACGGCACGAATGTCGCGCCTTTCCCGCCGCAGGCCATGACCACGGAAGCCGCCCGC
GCCGCCTTTGCCGTGACCGAACGGACACTCGCGGCGGTGGCCGATCAAACGGCCCTATTGCCGCGCGTCG
TCGACAAGGACGTCGTTGCATCAATCGTTGCCCGCTGGACCGGAATTCCTGTCGGCAAGCTGTTGGCCGA
CCAGATCGAAACCGTCAAGACACTGGATGCCCGCCTGAAGGAGAGGGTGCTCGGCCAGGACGCTGCGATC
GAACGCATCGCTTCGGCCATGCGGGCCGCCCGCGCCGGACTTTCCGATCCGCGCCGGCCGCCGGCCGTCT
TCCTGCTCGTCGGCATGTCCGGCACCGGCAAGACCGAGACGGCGCTGTCGCTTGCCGACATGCTCTATGG
CGGCAGCCGGTATCTCACGACCATCAACATGTCCGAGTTCAAGGAGGAGCATAAGATTTCCATGCTTCTC
GGCTCGCCCCCCGGTTACGTCGGTTACGGCGAAGGCGGCGTGCTGACCGAGGCGGTGAGGCGCAGGCCCT
ATGGGGTGCTGCTGCTCGACGAGATCGACAAGGCCCATCCCGGCGTTCAGGAAATCTTCTACCAGGTGTT
CGACAAGGGAACGCTGCGCGACGGCGAAGGCCGCGACATCGATTTCAAGAACACCACCATCGTTATGACC
GCCAATACCGGTTCGGAAATGATCGCCGCACTTGCCGCCGATCCCGAGACGATGCCGGAGGCGGAAGCGC
TGGAGGCGATGCTGCTGCCGGAATTGCAGAAGCATTTCAAGCCGGCCTTCCTCGGCCGCACGACGGTGCT
GCCCTTCATGCCGCTTGGGCCGGAGACGCTGTCCGGCATCGTCGATATCCAGATCGGCCGCATCCGCGAG
CGGGTGGGCGCCAGCTACGGCGCGGCGCTTTCGCTCTCGCCGCAAGCGCGCGAGGCGCTGATTTCCCGCG
GCCGCACGAGCGAGATGGGCGCTCGCGCAATCGAGGTCATGATCGCCCGCGACCTCCTGCCTGTTCTTTC
GACCTATTTCCTCGATGCCGTCGCGGCCGGGAAGAAGATCAAAGGGATCGCCATCAATTATGACGGCCAT
CGCTTCGGCCTCGACGCCGAGGAGGCCGCCGCACAGGAATTCGGCACGCCGGGGGAAAGCCGGTTGTCGG
ATGAAGTAGCCCCGGGCCGCAAGCGCACTCGGGGAGCAGGACGAAGAAAGGCGACTACGCCTTAG
 Primer design