SecReT6
Protein ID: 528837991
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00477
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]510582..511058 [+]
Productvirulence factor secretion protein
NoteTssD
UniProt IDS5SWA4
KEGG IDrel:REMIM1_PF00477
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-33, Aligned region: 4..134
Protein Sequence: 158 a.a.     [Download]
>gi|528837991|ref|YP_008369071.1| virulence factor secretion protein [Rhizobium etli bv. mimosae str. Mim1]
MPIYLQIDGIQGDATHEQHRKWMDIEAIHWNVSRNMNTSAGSAANREASEPTVSEVILTKVSDSSSTKLF
QEACSGRTGKRSVIHLVTTGNPGDTYIEYSLENTLIASYSIDSNGDRPVETIKLNFTKMEVKYTPYDDKH
SPQSPMIASYDLATTKAA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|528837521|ref|NC_021911.1|:510582-511058 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGCCGATTTATCTTCAGATCGACGGTATCCAGGGTGATGCGACCCACGAGCAGCATCGCAAGTGGATGG
ACATCGAAGCCATCCACTGGAACGTATCCCGCAACATGAACACCTCCGCTGGTTCTGCGGCCAACCGCGA
AGCTTCCGAGCCGACCGTTTCGGAAGTGATCCTCACCAAGGTCAGCGATTCCTCGTCGACCAAGCTCTTC
CAGGAGGCCTGCTCCGGCCGCACCGGCAAGCGCTCCGTCATCCATCTCGTCACCACGGGCAATCCCGGCG
ACACCTATATCGAGTACTCGCTCGAGAACACGCTGATCGCCAGCTACTCGATCGATTCCAACGGCGACCG
CCCGGTCGAGACGATCAAGCTGAACTTCACCAAGATGGAAGTGAAGTACACGCCTTACGACGACAAGCAC
TCGCCGCAGTCGCCGATGATCGCGTCTTACGATCTCGCCACCACCAAGGCCGCTTAA
 Primer design