SecReT6
Protein ID: 528837994
SecReT6 ID836
T6SS typei5
Gene symbol-
Locus tagREMIM1_PF00480
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021911] [Browse all T6SS(s) in this replicon]
Location [Strand]513253..515517 [+]
Producttype VI secretion system Rhs element Vgr family protein
NoteTssI
UniProt IDS5S8B9
KEGG IDrel:REMIM1_PF00480
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-64, Aligned region: 37..347
Phage_base_V [PF04717], Evalue: 9.50E-19, Aligned region: 214..233
Phage_base_V [PF04717], Evalue: 9.50E-19, Aligned region: 385..478
Protein Sequence: 754 a.a.     [Download]
>gi|528837994|ref|YP_008369074.1| type VI secretion system Rhs element Vgr family protein [Rhizobium etli bv. mimosae str. Mim1]
MDDLQSLAADFIQANRILKIVSPLGEDQLLPERVTIEEGISSLFEIKISARAKKPSVKPEELIGRLMDVS
VEVQQGDGEGALRRPFNGLVTELNEGPPITRGLRSYSMVLRPQMWLLSRRSDCRIWMDKTSVDIVETLFS
EHGIPAPDTSGVITPPPPQHYSVQWNETDLAFLTRRFEEDGLFYWFSHEDGKHKLHVADSAQSWLGPSPS
AQGEGRVRLAQGSADRNHITEWSRRYSYVPGQRAGADWNFETPRMVPGTMTPSLVQLPEASKRELYEYPA
RISSVAEAERAEKLRMQASEADHDRVFGGSTSRILEAGRRFTPYEVAHPDHVYEEHVVVKATHTVVDRSY
ETNSNEPEYTNTFEAVPSRVPMTPHRETKRPRIEGTQVAIVAGPSGEEIHPDQYGRIKLWFPWDRKAKKD
GSDTCWVRVSQVWGGGTWGAQVIPRIGMEVMVAFVDGDPDRPLVTGVVPNPSNTVPYDLPANKTRMVMRS
NTHKGTGFNEMTFEDEAGQENMFFHAQKDQTTRVLNDRIKRVDRHEVSAIGGNRAVEVSGNQKHEIGGSV
NTVVGGTGPMAMALMGAVSGLSGHTAGLLAQAGQIAGGGGAGLAAFAGTVASSALGFLGAGGLGSREGVV
SGPSPRADAGTALAGSGTGVGDAASGLFPMPGIMNTIVGAFKSDTIGIARAEQIGMSKVTNVGQTSLESV
GKFKKIAVGEEFVIECGDSKFIMKANGEVIILGKTFNFVATEHFQMRGKPIDLN
 
Nucleotide Sequence: 2265 bp     [Download]
>gi|528837521|ref|NC_021911.1|:513253-515517 Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence
ATGGACGATTTGCAATCCCTTGCCGCCGACTTCATCCAGGCGAACCGTATTCTGAAGATCGTCTCGCCGC
TTGGCGAGGACCAGCTTCTGCCGGAGCGGGTGACGATCGAGGAAGGCATTTCTTCGCTCTTCGAAATCAA
GATTTCGGCGCGTGCCAAGAAGCCGTCGGTTAAGCCGGAGGAACTGATCGGCCGGCTAATGGATGTCTCC
GTGGAGGTGCAGCAGGGCGATGGCGAAGGCGCCCTGCGCCGGCCGTTCAACGGCTTGGTGACCGAACTCA
ACGAGGGGCCGCCGATCACCCGCGGGCTGCGCTCCTACTCCATGGTGCTGCGGCCGCAGATGTGGCTCTT
ATCGCGCCGCTCCGACTGCCGTATCTGGATGGACAAGACCTCGGTCGACATCGTCGAAACGCTGTTTTCC
GAACATGGAATCCCGGCACCCGATACGTCGGGCGTCATCACGCCACCGCCGCCGCAGCATTATTCGGTGC
AGTGGAACGAAACCGATCTTGCCTTCCTCACCCGCCGTTTCGAAGAGGACGGCCTGTTCTACTGGTTTTC
GCATGAGGACGGCAAACACAAGCTGCATGTGGCCGACAGCGCCCAATCCTGGCTCGGCCCCTCGCCATCG
GCGCAGGGGGAGGGTCGGGTTCGCCTGGCGCAGGGCTCGGCCGACCGCAATCACATCACCGAGTGGAGCC
GGCGTTATTCCTATGTGCCGGGCCAGCGCGCCGGCGCCGACTGGAACTTCGAAACCCCACGCATGGTGCC
CGGCACGATGACCCCGTCTCTGGTGCAGCTGCCGGAAGCGAGCAAGCGCGAGCTTTACGAATATCCGGCG
CGCATCTCTTCCGTCGCCGAGGCGGAGCGGGCGGAGAAACTGAGGATGCAGGCCTCCGAGGCCGATCACG
ACCGGGTCTTCGGCGGCTCGACATCCCGCATCCTGGAGGCCGGACGCCGCTTCACACCTTATGAGGTCGC
TCATCCCGACCATGTCTATGAGGAGCATGTGGTGGTCAAGGCGACCCATACGGTCGTCGACCGCTCCTAT
GAGACCAACAGCAACGAGCCGGAATATACCAATACCTTCGAGGCGGTGCCGTCGCGGGTGCCGATGACGC
CGCACCGCGAGACGAAGCGGCCGCGCATCGAGGGCACGCAGGTGGCGATCGTCGCCGGCCCTTCCGGCGA
GGAGATCCATCCCGACCAATACGGCCGCATCAAGCTGTGGTTCCCCTGGGACCGCAAGGCCAAGAAGGAC
GGCTCCGACACTTGCTGGGTGCGGGTCAGCCAGGTCTGGGGCGGCGGCACCTGGGGCGCGCAGGTTATCC
CGCGCATCGGCATGGAGGTGATGGTCGCCTTCGTCGACGGCGACCCCGACCGGCCGCTGGTAACAGGCGT
GGTGCCCAATCCCAGCAACACGGTTCCCTACGATCTGCCTGCCAACAAGACCCGCATGGTCATGCGCTCC
AACACCCACAAGGGCACCGGCTTCAACGAAATGACCTTCGAGGACGAGGCCGGCCAGGAGAACATGTTCT
TCCATGCGCAGAAGGACCAGACGACGCGCGTGCTGAATGACCGCATCAAACGCGTCGACCGGCATGAGGT
CTCGGCCATCGGTGGCAACCGCGCGGTGGAGGTGAGTGGCAATCAGAAGCACGAGATCGGCGGTTCGGTG
AACACGGTCGTCGGCGGCACCGGGCCGATGGCGATGGCGCTGATGGGGGCGGTCAGTGGTCTCTCCGGAC
ATACCGCCGGGCTCCTGGCCCAGGCCGGGCAAATTGCAGGCGGCGGCGGGGCAGGGCTTGCGGCCTTCGC
CGGCACGGTTGCGTCTTCGGCGCTCGGCTTTCTCGGCGCTGGCGGGCTGGGCAGCCGTGAGGGCGTGGTG
TCGGGACCGTCGCCAAGAGCGGATGCGGGCACGGCGCTTGCCGGTTCCGGCACGGGTGTTGGCGATGCGG
CTTCGGGCCTTTTCCCAATGCCCGGCATCATGAACACAATCGTCGGCGCCTTCAAATCCGACACGATCGG
CATTGCCCGCGCCGAGCAGATCGGCATGAGCAAGGTCACCAATGTCGGTCAGACCTCGCTGGAGAGCGTC
GGCAAGTTCAAGAAGATCGCGGTCGGCGAGGAATTTGTCATCGAATGCGGCGATTCCAAATTCATCATGA
AAGCCAACGGCGAAGTGATCATCCTCGGCAAGACGTTCAACTTCGTTGCGACCGAACACTTCCAGATGCG
CGGCAAGCCGATCGACCTGAACTGA
 Primer design