SecReT6
Protein ID: 528986901
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051531
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5507167..5510973 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDR4XWT0
KEGG IDaxo:NH44784_051531
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.90E-73, Aligned region: 201..461
IcmF-related [PF06761], Evalue: 4.20E-53, Aligned region: 506..854
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 79..118
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 801..814
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 981..1099
Protein Sequence: 1268 a.a.     [Download]
>gi|528986901|ref|YP_008032218.1| IcmF-related protein [Achromobacter xylosoxidans NH44784-1996]
MRSPSGFFSGISSALSEGRHWTSRALGNPRLFMAIGLIALVVFLFLFADTVEIGLAWAGIALGIFLLLWL
CAYLWRRRRARRANKNLGDMLEQQVQTGSAAANRGDVDALRTRLVQAVRTIKTSKIGQVSGNEALYELPW
YIVIGNPAAGKSSAVINSGLQFPFADKNGAAVRGVGGTRNCDWFFTTEGILLDTAGRYSVHEEDRNEWMG
FLDLLKRHRPKAPINGIIVAASIDELTGAGPEFAINLAKNLRQRVQELTDRLEVFAPVYIIFTKADLISG
FSEFFSDSDQRERDRVWGATLPYGAEENRDVLALFDERFDELYEGLKEMGTAQISLRNNRELPPGLLTFP
LEFAGIKPALRTFLSTLFETNPFQYKPVFRGFYFTSALQEGVSQSTSTERLAERFDLRPAARGQARNVSS
HNGFFLRDLFSSVIFADKKLVRQHASPAKTRMRYLTFFGLVLALGLVLGGWSWSYLGNRQLAQNVQADLD
KVVRLQSERTDLQSRLEAMEILQDRIEQLDRYSSSRPWSLGLGLYQGDVLKERLLAEYYNGARQFMLSPV
KASLEDFLAKVDMSGAAAAAGGAQQPAPQAVRASHVPGGDTLFQDASPTNADDAYNALKTYLMMANRQHV
DPTHLSDQITRFWRGWLETNRGAMPRDQLIRSAERLISFYVSRAPDAGWPQIDTNLALVEKTRASLRAVM
QGMPARERAYATLKARAATRFQTMTVARIVGENDAGVVAGSYAIPGTFTREAWEQYIQPAINEAAKKEVQ
TSDWVLGVNARDDLTLDGSPEQIQKSLATMYKTEYAQEWQKFLRGVTIKPFTSFEQSVGAMNRLGDPQTS
PIAKLINTAYEQTSWDNPSLVNAGLQQAQSGVVGWFKRVILRQTPPAPTPATTANGEAIPMGPVGREFSD
VARLVVTRENQSLLGNYMGALSKIRTRFNLLNNQGDPGPGSLVLLRQTLEGKDSELADALKLVDEQMLAG
LSATQRETLRPLLVRPLIQAYAVAMQPAERELNKVWNAQIYQPFNQTLAEKYPFAARASVEASSDEIGQV
FGPQGSIAKYVNDTLGPLTVRRGDILTARTWGDMGISLQPTFTANFAQWVAPLSGGAGAGSASQPQTLFQ
IQPKPASGVTEYTIEIDGQQLRYRNTPPQWVNFVWPNAQGAPGARITATTFDGSVVEIVNEPGRFGLERL
IATAQRTANADGSFNMSWGKSNVTVPVKLRIISNAQAPGAGGSEPGGSQGLRNLRLPSSVVGASPESSSA
QTRPGAPQ
 
Nucleotide Sequence: 3807 bp     [Download]
>gi|528981796|ref|NC_021285.1|:5507167-5510973 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGCGTAGCCCTTCAGGTTTCTTTTCCGGTATCTCCAGCGCCCTGAGCGAAGGTCGCCATTGGACCTCCC
GCGCCCTCGGCAATCCGCGCCTGTTCATGGCGATCGGCCTGATCGCCCTGGTCGTGTTCCTGTTCCTGTT
TGCCGACACCGTCGAGATCGGCCTGGCCTGGGCCGGCATCGCGCTGGGAATATTCCTGTTGCTCTGGCTG
TGCGCCTATCTGTGGCGCCGGCGCCGCGCGCGCCGCGCCAACAAGAACCTGGGCGACATGCTGGAGCAGC
AGGTGCAGACCGGCAGCGCGGCCGCCAATCGCGGGGACGTGGACGCGCTGCGCACGCGCCTGGTGCAGGC
GGTGCGCACCATCAAGACGTCCAAGATCGGCCAGGTGTCGGGCAACGAAGCGCTGTACGAACTGCCCTGG
TACATCGTGATCGGCAACCCCGCCGCGGGCAAGAGCAGCGCGGTGATCAATTCCGGCCTGCAATTCCCCT
TCGCCGACAAGAACGGCGCGGCGGTGCGCGGCGTGGGCGGCACCCGCAACTGCGACTGGTTCTTCACCAC
CGAAGGCATCCTGCTGGACACGGCCGGCCGCTACTCGGTGCACGAGGAAGACCGCAATGAATGGATGGGT
TTTCTCGACCTGCTCAAGCGTCATCGCCCCAAGGCGCCGATCAACGGCATCATCGTGGCCGCCAGCATCG
ACGAGCTGACCGGCGCCGGGCCGGAATTCGCCATCAACCTGGCCAAGAACCTGCGCCAGCGCGTGCAGGA
ACTGACCGACCGGCTGGAAGTGTTCGCGCCGGTCTACATCATCTTCACCAAGGCCGACCTGATCTCGGGC
TTCAGCGAATTCTTCTCCGACAGCGACCAGCGCGAGCGCGACCGCGTCTGGGGCGCCACCCTGCCCTACG
GCGCGGAAGAGAACCGCGACGTGCTGGCCCTGTTCGACGAACGCTTCGATGAACTGTACGAAGGCCTCAA
GGAAATGGGCACGGCGCAGATCTCGCTGCGCAACAACCGCGAACTGCCGCCGGGACTGCTGACCTTCCCG
CTGGAGTTCGCCGGCATCAAGCCGGCGCTGCGCACCTTCCTGTCGACGCTGTTCGAGACCAACCCGTTCC
AGTACAAGCCCGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCGTGTCGCAAAGCACCTC
GACCGAACGGCTGGCCGAACGCTTCGACCTGCGCCCGGCCGCCCGCGGCCAGGCGCGCAACGTGTCCTCG
CACAACGGCTTCTTCCTGCGCGACCTGTTCTCCAGCGTGATCTTCGCCGACAAGAAACTGGTGCGCCAGC
ACGCCAGCCCGGCCAAGACCCGCATGCGCTACCTGACCTTCTTCGGCCTGGTGCTGGCGCTGGGCCTGGT
GCTGGGCGGCTGGAGCTGGTCATACCTGGGCAACCGCCAGCTGGCGCAGAACGTGCAGGCCGACCTGGAC
AAGGTGGTGCGCCTGCAAAGCGAGCGCACCGACCTGCAGAGCCGCCTGGAGGCCATGGAGATCCTGCAGG
ACCGCATCGAGCAGCTGGACCGCTATTCGTCCAGCCGCCCGTGGTCGCTGGGCCTGGGCCTGTACCAGGG
CGACGTGCTCAAGGAGCGCCTGCTGGCCGAGTACTACAACGGCGCGCGCCAGTTCATGCTGAGCCCGGTC
AAGGCCAGCCTGGAGGACTTCCTGGCCAAGGTCGACATGTCCGGCGCCGCGGCGGCGGCCGGCGGCGCGC
AGCAGCCGGCGCCGCAGGCGGTGCGCGCCTCGCACGTCCCGGGCGGCGACACGCTGTTCCAGGATGCCTC
GCCGACCAATGCCGACGACGCCTACAACGCGCTCAAGACGTACCTGATGATGGCCAATCGCCAGCACGTC
GACCCCACCCACCTGTCCGACCAGATCACGCGCTTCTGGCGCGGCTGGCTGGAGACCAACCGCGGCGCCA
TGCCGCGCGACCAGCTGATCCGCAGCGCCGAACGCCTGATCTCGTTCTACGTCAGCCGCGCGCCCGACGC
CGGCTGGCCGCAGATCGACACCAACCTGGCGCTGGTGGAAAAGACCCGCGCCAGCCTGCGCGCCGTGATG
CAGGGCATGCCGGCGCGCGAACGCGCCTACGCCACGCTCAAGGCGCGCGCCGCCACGCGCTTCCAGACCA
TGACGGTGGCGCGCATCGTCGGCGAGAACGACGCCGGCGTGGTGGCCGGCAGCTACGCCATCCCCGGCAC
CTTCACCCGCGAGGCCTGGGAGCAGTACATCCAGCCCGCCATCAACGAGGCCGCCAAGAAGGAAGTGCAG
ACCAGCGACTGGGTGCTGGGCGTGAACGCGCGCGACGACCTGACCCTGGACGGCAGCCCCGAACAGATCC
AGAAGAGCCTGGCGACGATGTACAAGACGGAGTACGCGCAGGAATGGCAGAAGTTCCTGCGCGGCGTGAC
CATCAAGCCCTTCACCAGCTTCGAGCAGTCGGTGGGCGCGATGAACCGCCTGGGCGACCCGCAGACCTCG
CCCATCGCCAAGCTCATCAACACCGCCTATGAACAGACCTCGTGGGACAACCCGTCGCTGGTCAACGCCG
GCCTGCAACAGGCGCAGAGCGGCGTGGTCGGCTGGTTCAAGCGCGTGATCCTGCGGCAGACGCCGCCCGC
GCCCACGCCCGCCACCACCGCCAACGGCGAAGCCATTCCGATGGGTCCGGTGGGCCGCGAGTTCTCGGAC
GTGGCGCGCCTGGTGGTGACGCGCGAGAACCAGTCGCTGCTGGGCAACTACATGGGCGCGCTGTCCAAGA
TCCGCACCCGCTTCAACCTGCTCAACAACCAGGGCGACCCCGGCCCCGGCTCGCTGGTGCTGCTGCGCCA
GACGCTGGAGGGCAAGGATTCGGAGCTGGCCGACGCGCTCAAGCTGGTCGACGAGCAGATGCTGGCCGGC
CTGTCGGCGACGCAGCGCGAGACGCTGCGCCCGCTGCTGGTGCGGCCGCTGATCCAGGCCTACGCCGTGG
CCATGCAACCGGCCGAACGCGAGTTGAACAAGGTCTGGAACGCGCAGATCTACCAGCCCTTCAACCAGAC
CCTGGCCGAAAAGTACCCGTTCGCCGCGCGCGCCAGCGTCGAGGCCAGCAGCGACGAGATCGGCCAGGTG
TTCGGTCCGCAGGGCAGCATCGCCAAGTACGTCAACGACACCCTCGGCCCGCTGACCGTGCGCCGCGGCG
ACATCCTGACGGCGCGCACCTGGGGCGACATGGGCATCAGCCTGCAGCCGACCTTCACCGCCAACTTCGC
GCAGTGGGTGGCGCCGCTGTCCGGCGGCGCGGGCGCAGGCTCGGCCAGCCAGCCGCAGACGCTGTTCCAG
ATCCAGCCCAAGCCGGCCTCGGGCGTGACCGAGTACACCATCGAGATCGACGGCCAGCAGCTGCGCTACC
GCAACACGCCGCCGCAGTGGGTCAACTTCGTCTGGCCCAACGCCCAGGGCGCGCCCGGCGCGCGCATTAC
CGCCACCACCTTCGACGGCAGCGTGGTCGAGATCGTCAACGAACCGGGACGCTTCGGCCTGGAGCGCCTG
ATCGCGACCGCCCAGCGCACCGCCAACGCCGACGGCAGCTTCAACATGAGCTGGGGCAAATCCAACGTGA
CGGTGCCGGTCAAGCTGCGCATCATCAGCAACGCCCAGGCGCCCGGCGCCGGCGGCAGCGAGCCCGGCGG
CAGCCAGGGCCTGCGCAACCTGCGCCTGCCCTCCTCCGTGGTGGGCGCCTCCCCCGAATCCTCCTCCGCC
CAGACGCGACCCGGAGCGCCGCAATGA
 Primer design