SecReT6
Protein ID: 529236506
SecReT6 ID838
T6SS typei1
Gene symboltssN
Locus tagBB2000_0808
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]920271..923819 [-]
ProductTssN
NoteTssM
UniProt IDS5U8F2
KEGG IDpmib:BB2000_0808
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.10E-80, Aligned region: 212..248
IcmF-related [PF06761], Evalue: 4.10E-80, Aligned region: 514..827
ImcF-related_N [PF14331], Evalue: 2.40E-66, Aligned region: 211..467
ImcF-related_N [PF14331], Evalue: 2.40E-66, Aligned region: 767..807
ImcF-related_N [PF14331], Evalue: 2.40E-66, Aligned region: 908..941
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 311..329
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 604..630
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 722..738
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 749..788
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 921..1040
Protein Sequence: 1182 a.a.     [Download]
>gi|529236506|ref|YP_008397365.1| TssN [Proteus mirabilis BB2000]
MKLPVFSISNITSSVKKLFFADKSKIASFLLFLLALLPALLIIWIWWWGPTFRYQDSIPFSEVTTRWLAT
VVIVLLVVSWIGLATWRRVKKLEALKLDVELAVVDPVRQDLDFQKRYLNYWKSQFIRHLNGHTKAVYLRP
WYFVLGANQSGKHSLLKNTVNPLDIAPSDNIVNEQNIALNIQCLLTDNAVLFVPNGDLLTQPANQADKPQ
LYHRLWGDLLNWIKTNRPRQPMNGIVLTVDTLSLLTNSKEQNSQLLADLQMRIEEIRMTFNSRLPLYIVL
TKLDLLRGFDSMYQSLDVQQRNEVLGVSFNQKAKSNWKKELNHFWSQWVGQMNSALPEMMLQRAEGNQRS
DLFSFVRQIEGLQHSVCTLIDALLINNEQHNICLRGVYLTSALQIGQIDDVFSQTASEQYHLPTAPLTTW
PINDSHPYFTTQLFSQVLFSEPNIAAENHYWVKKHRTRLLVTTAVSFVGLIAIWNGWSHYYDKNYRAGEN
VLNEVKAFRAIENNAQKDTDGSLQLPVLNPLREATLAYGNHRDKNVLFSDMGLYQGQKVGPQVEQVYLQL
LTDRFLPAVMSGLLNELNSADKGSEDKLEILRIMRMLEDKSGRNNGMVEDFMADYWSQLFTGQREKQLQL
KAHLRYALEHTDWKQEREKGFVSATKAFMPFAGPIKNAQAELSVLSLYQRVYQALRLKANQELSAPLNLQ
HQIGPSFNTVFTAIDDDKLEIPQFLTRSGLLNYFIRQNDKLVELTLLDAWVLNLTTNTQYSESDRKEIQR
QISEQYLSDYTAQWRNAMSNLEIRQFDSIQDEITALEQIISGEQPLRRALQVLRDNTVIPTIDENLPLDE
QKTLMAEPSYRLLTRLDREFTPQTEILVSNQGENLQNLNQKLNDLHRYLLGIQNSPVPGKAALKAVSMRL
NDNNRDAIFELSQMAKTLPEPLNRWVDELSVQAWNVVQKEAIRYMEVEWNENVVKQYNTYIAGRYPFNPA
AKQDVPLSEFERFFKPNGTLDSFYQQNLRLFVENNLVNDSDSQSLIRADVLAQIEIANRIRETFFNAQGN
LEAQYAIEPLSLSGNKRRSILNLDGQLIDYAHSRSHVTHLVWPNSMRSNIESKLTLVPLSGDKSPRSISF
SGPWAQMRLVDNAKLINIKPNSFDIRFTIDGGDMTYRVIVDESNNPFFGGLFTKFRLPETLY
 
Nucleotide Sequence: 3549 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c923819-920271 Proteus mirabilis BB2000, complete genome
ATGAAATTACCGGTTTTCTCCATTTCAAACATTACGAGTTCGGTAAAAAAACTCTTTTTTGCTGATAAAT
CTAAAATTGCCTCCTTTTTGCTATTTTTATTGGCATTACTTCCCGCTTTGCTCATTATTTGGATCTGGTG
GTGGGGGCCAACATTTCGTTATCAAGATTCCATACCGTTTAGCGAGGTCACCACACGTTGGTTAGCAACC
GTCGTTATTGTATTGCTTGTTGTGAGTTGGATTGGTCTAGCAACATGGCGTCGAGTTAAAAAATTGGAAG
CATTAAAACTTGATGTCGAATTAGCTGTAGTTGATCCGGTAAGACAAGATCTTGATTTTCAAAAACGTTA
TTTAAACTATTGGAAATCACAATTTATTCGTCACTTAAATGGTCATACTAAAGCGGTTTATTTACGCCCT
TGGTATTTTGTTTTAGGTGCTAACCAAAGTGGAAAGCATAGCTTATTAAAAAATACGGTAAACCCATTAG
ATATTGCGCCTAGCGACAATATTGTTAACGAACAAAATATTGCATTAAATATTCAATGTCTATTAACCGA
CAATGCTGTACTTTTTGTCCCTAATGGTGATCTATTAACCCAGCCGGCAAATCAGGCTGATAAACCTCAA
CTTTATCACCGTTTGTGGGGCGATTTACTCAATTGGATCAAAACTAACCGCCCAAGACAACCAATGAATG
GCATCGTCTTAACTGTCGATACCCTATCGTTATTAACCAATAGTAAGGAGCAAAATAGTCAGCTACTTGC
TGATTTACAAATGCGTATTGAAGAAATACGCATGACATTTAATAGTCGCTTGCCTTTATATATCGTCTTA
ACCAAGCTAGATCTATTACGTGGTTTTGACTCAATGTATCAATCATTAGATGTTCAACAACGTAATGAAG
TATTAGGTGTTTCTTTCAACCAGAAAGCAAAAAGTAATTGGAAAAAGGAATTAAATCATTTTTGGTCACA
ATGGGTAGGCCAAATGAACAGCGCATTACCAGAAATGATGCTACAAAGAGCAGAAGGTAACCAGCGTAGT
GATCTATTTAGTTTCGTGCGCCAAATTGAAGGGTTACAACATTCTGTATGCACATTAATTGATGCATTGC
TCATCAATAATGAGCAACATAATATCTGTTTAAGAGGGGTTTATTTAACTTCTGCATTGCAAATCGGTCA
AATCGATGATGTGTTTAGCCAAACAGCGTCCGAACAATATCATTTACCAACAGCACCTCTTACTACATGG
CCAATTAATGATAGCCACCCTTATTTTACTACCCAATTATTTAGTCAAGTGCTATTTAGTGAGCCTAATA
TTGCAGCAGAAAACCATTATTGGGTTAAAAAACATCGGACTCGCCTATTAGTCACCACTGCTGTTAGCTT
TGTCGGCTTAATCGCAATTTGGAATGGTTGGAGCCACTATTACGACAAAAACTATCGTGCTGGAGAAAAC
GTTCTTAATGAGGTAAAAGCATTCCGTGCTATTGAGAACAATGCTCAGAAAGATACTGATGGTAGCCTAC
AATTACCGGTGCTCAATCCATTACGTGAAGCAACCTTAGCTTATGGTAATCATCGTGATAAAAATGTGCT
CTTTTCTGATATGGGTCTTTACCAAGGTCAAAAAGTAGGCCCACAAGTTGAACAAGTCTATTTACAACTA
CTCACCGATCGCTTTTTACCTGCGGTTATGTCTGGGTTGTTAAATGAACTTAACAGTGCCGATAAAGGAA
GTGAAGATAAGTTAGAGATATTGCGTATTATGCGCATGTTAGAAGATAAAAGTGGCCGTAATAATGGCAT
GGTAGAAGATTTTATGGCTGATTATTGGAGCCAACTGTTCACTGGTCAACGTGAAAAACAACTGCAACTA
AAAGCCCATTTGCGCTATGCCCTTGAGCACACAGATTGGAAACAAGAGCGTGAAAAAGGGTTTGTTTCAG
CCACTAAAGCCTTTATGCCTTTTGCTGGACCTATAAAAAATGCACAAGCAGAGTTAAGTGTATTGTCACT
TTATCAGCGTGTATATCAAGCCTTACGCTTAAAGGCTAATCAAGAGCTTTCAGCGCCTTTAAATTTACAA
CATCAAATTGGCCCAAGTTTTAATACGGTCTTTACGGCTATTGATGATGATAAATTAGAAATTCCACAAT
TCTTAACGCGCTCAGGGTTATTAAACTATTTTATCCGCCAAAATGATAAATTGGTCGAGCTAACATTACT
TGATGCTTGGGTTCTTAATCTAACCACCAACACACAATATAGTGAAAGTGATCGTAAAGAAATTCAGCGT
CAAATCAGTGAACAATATCTTAGTGACTATACGGCTCAATGGCGTAATGCCATGAGCAATTTAGAAATTC
GTCAATTTGATTCAATACAAGATGAAATTACCGCTCTTGAGCAAATTATTAGTGGTGAACAACCATTACG
CCGAGCATTACAAGTTCTACGTGATAACACGGTTATTCCAACTATTGATGAAAATTTACCACTTGATGAA
CAAAAAACACTGATGGCTGAGCCATCTTACCGTTTATTAACCCGCTTAGATCGCGAATTTACTCCTCAAA
CTGAGATATTAGTCAGTAACCAAGGGGAAAATTTACAGAATCTGAATCAAAAACTAAATGACTTACATCG
TTACCTATTGGGGATCCAAAACTCTCCAGTGCCGGGGAAAGCGGCGCTTAAAGCAGTTTCGATGCGCTTA
AACGATAATAATCGCGACGCTATTTTTGAGCTATCACAAATGGCGAAAACATTACCAGAGCCGCTTAACC
GCTGGGTCGATGAGTTATCAGTGCAAGCATGGAATGTGGTCCAAAAAGAAGCTATTCGTTATATGGAAGT
AGAATGGAATGAAAATGTTGTCAAACAATACAATACTTATATTGCCGGTCGTTATCCATTTAACCCAGCA
GCTAAACAAGATGTTCCTTTAAGTGAATTTGAACGTTTCTTCAAACCAAATGGAACATTAGATAGCTTCT
ATCAACAAAATCTGCGTTTATTCGTTGAGAATAACTTAGTTAACGATAGTGATAGCCAATCATTGATCCG
CGCTGATGTATTAGCACAAATTGAAATAGCCAATCGTATTAGAGAAACCTTCTTTAATGCCCAAGGTAAT
TTAGAAGCACAATATGCTATTGAGCCACTGTCATTAAGTGGTAATAAGCGTCGTAGCATCTTAAATCTTG
ATGGACAATTGATTGATTACGCTCATAGTCGCAGCCATGTGACACACTTGGTATGGCCAAACTCAATGCG
TTCCAATATTGAAAGTAAACTGACTTTAGTGCCTCTTTCCGGTGATAAATCGCCACGTTCAATCAGTTTC
TCTGGGCCATGGGCACAAATGCGATTAGTTGATAATGCAAAACTCATTAATATCAAACCTAACTCATTCG
ATATTCGCTTCACAATCGACGGTGGTGATATGACTTATCGAGTTATAGTTGATGAATCTAATAATCCTTT
CTTCGGTGGATTATTCACAAAATTCCGTTTACCTGAAACGCTTTATTAA
 Primer design