SecReT6
Protein ID: 529988757
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3167
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3243587..3244999 [-]
Producthypothetical protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.90E-51, Aligned region: 35..60
DUF3702 [PF12486], Evalue: 2.90E-51, Aligned region: 89..177
DUF3702 [PF12486], Evalue: 2.90E-51, Aligned region: 302..446
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 40..99
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 323..339
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 355..373
Protein Sequence: 470 a.a.     [Download]
>gi|529988757|ref|YP_007992143.1| unnamed protein product [Klebsiella pneumoniae]
MTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLARA
RLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSLQ
SFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAANVEPVP
DLKRRPKAEPLVPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVTQ
NAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSAG
ALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPVD
QPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALTATGEPSVSEAVK
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3244999-3243587 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGACAACACACCACGACCGTCACTATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGGCCC
TGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCAGCT
TGCCCGCGGGCTGTTGGAGCATCACGGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGCGCC
CGGCTGGGCGGGGTGGCAGGGATCAATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGGGGA
AAAACCTGTGGCCACAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCGGCA
GGTGATCCGTACCCTGAATCTTACCCCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTGCAA
AGCTTCGACGCAGTGCTCCAGCGCCTTGAGATCGCTCCTGAAAACCAGCTGAGCGACCTGCGGGCGCTAC
TGCACAGCACGGCAACTCGCTTCGAGAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGTGGC
GGTGTCTGACGCGGAACTTCCCGGCACTCTGGTCAGCGAAGAGGATGCGGCGAACGTTGAGCCAGTGCCA
GACCTAAAACGTAGACCAAAGGCTGAGCCGCTGGTCCCGCCTTCACCTGCAAAGCGGCCCGCGCCGGTGG
CGGCGTCTACTCCGGCAGCCGCGCCGCGCTGGAAGCCATTTATCGCCGGGATGGTTACCATGCTGGCGGT
AACGGGTATCGCCGTCGGCGGATGGCTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCGGTCACCCAA
AATGCCGGACCGATACCGGGCCTGCCGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGCAGC
GCCAGCTTGGCGAGCTTGCCCGCCTGGCGCCGGACTGGGCGGTCAGCTACGGCGACCAGCTGGTCCACCA
GGCCCTTATCCGCTGGCCGGATCAGGCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGCGCTGGC
GCATTGCCCGCGGAAAACCTTACCGGCTGGTCGGAGGGCATGCAGCAGCTGCAGCGGCTCGCCGACCAGC
TCAATGCCCTCGACGAGCAGAAGGGGAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGCCAT
CACGCAGTCGTTTAACCGCGCTGTTCCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTTGAT
CAACCCTGGCCAGCCGCGCGGGGAAGCCTCGCGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATGCCC
TGCTGAAGCGAAAACAGCCGGCGTCGCCGACCGCTGCGCTCACCGCAACCGGTGAGCCCTCGGTGAGTGA
GGCGGTGAAATAA
 Primer design