SecReT6
Protein ID: 529988758
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3168
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3245022..3245465 [-]
Producthypothetical protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.80E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|529988758|ref|YP_007992144.1| unnamed protein product [Klebsiella pneumoniae]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLNQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3245465-3245022 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATACTGTCA
GCGAAACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGCCGGAAC
GCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTGTCCTCCAGGGGATGCCAGCGTCGGCG
CATCAGCTGATGAGCACGTTGTCGGCGGTGTTGCTGAAATACGAACCGCGCCTGCAGCGGATCGCGGTGG
TGATGCTCAATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATATTGGCTT
GGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGTCAGCAGTAC
CTTGACGCCCGCTCCGCCCTCTAA
 Primer design