SecReT6
Protein ID: 529988759
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3169
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3245468..3246082 [-]
Producthypothetical protein
NoteTssJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.80E-38, Aligned region: 45..195
Protein Sequence: 204 a.a.     [Download]
>gi|529988759|ref|YP_007992145.1| unnamed protein product [Klebsiella pneumoniae]
MTTESRFIWGAISASGKISTAGRAMKMAITAVKPSARLLAFLMVTVLTGCGLTQTVKDGAVSVTQSIFYP
QVKTLHLDLRAREGVNNNAKGASLATVVRIYQLKDRQAFDNTDYPSLFAGDDQALHADRVAEKDVRLRPG
ESVTVDMPMETSAQFVAVAAMFIDPDLTQNSWRLVLTRDELDPARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 615 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3246082-3245468 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
CTGACGACAGAGTCACGATTTATCTGGGGCGCTATCAGCGCGTCCGGGAAAATATCCACCGCAGGGAGAG
CGATGAAGATGGCGATTACCGCAGTTAAACCCTCCGCCAGGTTGCTGGCATTCCTCATGGTTACCGTCTT
AACCGGCTGCGGCCTGACGCAGACCGTGAAAGACGGCGCCGTTTCCGTGACCCAGTCCATTTTTTACCCC
CAGGTGAAAACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGCCAAAGGCGCCTCCC
TGGCGACGGTGGTGCGTATTTATCAGCTGAAGGACCGGCAAGCGTTCGACAATACTGACTACCCGTCGCT
GTTTGCCGGCGATGACCAGGCGCTGCATGCGGACCGGGTGGCGGAAAAAGATGTTCGCCTGCGTCCGGGC
GAATCGGTGACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGCGGCCATGTTTATCG
ATCCAGACCTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGATCCGGCGAGGCCGCG
CATTATCGAAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA
 Primer design