SecReT6
Protein ID: 529988760
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3170
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3245985..3247031 [-]
Producthypothetical protein
NoteTssG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-82, Aligned region: 8..309
Protein Sequence: 348 a.a.     [Download]
>gi|529988760|ref|YP_007992146.1| unnamed protein product [Klebsiella pneumoniae]
MAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLLGDEPIRFRPHPGMGFPAGEIRGMDDPEPPRPPAV
RVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYSYPATFRAGGTDNISQ
YLLGLAGLGIPGCAAVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRATVYHHDPCRIPLSQPL
TMSVRQPVSLQHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMALLHVWLGSHLDVRLQL
CVARHLLPDAQLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENIHRRESDEDGDYRS
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3247031-3245985 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGGCGCAGCTCCGGCCTCAGTTGCCGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACC
ATCCGAAGGCGCCGATCATCGGCAGCGGCTGGCTATTAGGTGATGAACCCATACGCTTTCGCCCGCATCC
GGGGATGGGCTTTCCGGCTGGCGAAATCCGTGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTT
CGCGTGACTTTTATGGGACTCTACGGCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGC
AACGGCGGGAAGGCGTCGAGGCCACCGAGGATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTA
TTACCGTATCTGGCGCAAATATTCCTACCCGGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAG
TATCTGCTGGGCCTGGCGGGGCTGGGCATACCGGGATGTGCCGCCGTTGCCGCAGCGCCGCTGTCGCGAT
TTCTGGCGCTGCTGCCGGTGATGATGCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCT
CCTGGCCCCGGGGACCCGGGCGACGGTGTACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTA
ACGATGAGCGTCCGTCAGCCGGTTAGCCTGCAACATAGGCCAGTGATGGGAACCCACGCCACGGATGTGA
ACGGTCAGGTGTTGCTGCAGCTGGCCACGGAAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGA
ACTGTTCAGCGACCTGATGGCGCTTCTGCACGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTT
TGCGTCGCCCGCCATTTACTGCCGGATGCGCAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCC
GTACTGCTGTGCTGCGTCCTCTGGATGCGCAGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCG
CTATCAGCGCGTCCGGGAAAATATCCACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA
 Primer design