SecReT6
Protein ID: 529988762
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3172
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3248928..3252314 [-]
Producthypothetical protein
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.90E-75, Aligned region: 382..404
IcmF-related [PF06761], Evalue: 3.90E-75, Aligned region: 411..729
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 389..419
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 627..676
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 850..968
Protein Sequence: 1128 a.a.     [Download]
>gi|529988762|ref|YP_007992148.1| unnamed protein product [Klebsiella pneumoniae]
MNATDSILRLGSRFGVLMLIAGAMLWGIYHYGDKIGLNTLQAKLYFCLGLGILILLFRYGGRIVQFILGR
HLKGQGAPLTSGQHLKPASQSHRVVIEMRQTLRRQYGRFGAGKMTILMLTGSVADVERLAPGLSSQYWQE
NGDTLLLWGGEPQSASDNDWLFALRKRFCPPVNGLVWVTSAFDHLPAANQHVSPALLSMEDIDNIAHDLA
ERFSLLGWAVPLYVWSLHPQADDQAGRIVQSVGSLFPPDCQSSQVRQLLSALPSRLLETGVQQVTGNPQH
HFLLGLADQLTRQPERISVPLSTFLEHHRALPLAGVVFSPSSPQASHSLKHHWSHDKRWDVLLESLRPSG
LKARKIGFPWRRAVSASAAALMLLWAATLLVSFIANRELVATAQQQVQQASAEKQSLTLRLHALSALQKT
LSQLEYRSQHGAPWYFHAGLSQNDDLLAALFPRYGERAQPLLRDAAAEHLQRRLNAFVQLPPDSPLREKM
TKTAYGQLKRYLMLTRPEKMDATWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLASHPQWRLPVD
DGLVSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFTRQAWE
QAVQPAIEKVVAERRDEMDWVLSDTKQTAAQSTSPEALRARLAERYFADFSGAWLDFLNSLRWQRAATLS
DAIDQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVKSARQLFNRDNSPVIDQRSGARGPLDAT
FGPVLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLTKTRDY
GSLVAAGLGQEWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTSSEVSL
PLLAKYLDSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFANGEAG
LHFALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWISTRAGTRQYGDFPGAWG
WIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALRNFTLPETIFSVRASAERVPLTD
DIPGEEGY
 
Nucleotide Sequence: 3387 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3252314-3248928 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGAATGCAACGGATAGCATATTGCGCTTAGGTAGCCGTTTTGGGGTGCTGATGCTGATAGCTGGCGCAA
TGTTGTGGGGGATATATCACTATGGCGACAAGATTGGATTGAATACGCTGCAAGCGAAACTCTATTTCTG
CCTGGGCTTAGGGATCCTTATTCTGCTTTTTCGTTATGGCGGCCGTATTGTGCAGTTCATACTCGGCCGC
CATCTGAAGGGGCAGGGGGCGCCATTGACAAGTGGTCAGCATCTGAAGCCGGCTTCCCAGAGTCACCGCG
TAGTTATTGAGATGAGGCAGACATTGCGTCGCCAGTATGGTCGCTTTGGGGCTGGCAAAATGACCATTCT
GATGCTCACGGGAAGCGTGGCGGATGTTGAACGCCTTGCACCGGGCCTGAGTAGCCAGTACTGGCAGGAG
AATGGAGACACATTATTGCTTTGGGGTGGGGAACCCCAGAGCGCGTCGGATAATGACTGGCTTTTTGCTT
TGCGTAAACGCTTTTGCCCCCCTGTGAATGGGCTGGTGTGGGTCACTTCTGCGTTTGATCATCTGCCCGC
AGCCAATCAGCACGTATCCCCCGCTTTGTTGTCCATGGAGGATATAGATAACATTGCCCATGATCTGGCT
GAACGTTTCTCACTGCTAGGGTGGGCTGTACCACTGTATGTCTGGTCGCTGCATCCCCAGGCGGATGATC
AGGCCGGGCGCATCGTGCAATCTGTCGGCAGTCTCTTCCCGCCAGACTGTCAGTCGTCGCAGGTGCGCCA
GTTACTTTCGGCGTTGCCTTCAAGACTGTTAGAGACTGGAGTACAACAGGTCACGGGTAATCCGCAGCAT
CATTTTCTTCTGGGCCTGGCGGACCAACTCACGCGGCAGCCGGAGCGGATTAGTGTTCCCCTGTCGACGT
TTCTGGAACATCATCGTGCGTTACCGTTAGCCGGCGTTGTGTTCAGCCCGTCATCGCCGCAGGCGTCGCA
CAGCCTGAAGCATCATTGGAGCCACGATAAACGCTGGGACGTACTACTGGAATCTCTCAGGCCATCCGGC
TTAAAAGCACGAAAGATCGGCTTTCCCTGGCGAAGAGCTGTCTCCGCCTCCGCCGCCGCCCTGATGTTAC
TTTGGGCCGCCACTCTGCTGGTCTCTTTTATCGCCAACCGCGAGCTGGTGGCGACCGCACAGCAGCAGGT
GCAGCAGGCCTCAGCGGAGAAACAGTCGCTGACGCTCCGCCTGCATGCGCTCTCCGCGTTACAGAAAACG
CTTTCTCAACTGGAATACCGCTCACAGCACGGCGCGCCGTGGTACTTCCACGCTGGCCTCAGTCAGAACG
ATGACCTGCTGGCGGCTCTGTTCCCGCGCTACGGAGAGAGGGCGCAGCCGCTGCTGCGCGATGCGGCTGC
TGAACATCTTCAGCGGCGATTGAACGCCTTCGTACAGCTGCCGCCGGACAGCCCGCTGCGAGAGAAGATG
ACGAAAACCGCTTACGGACAACTGAAACGATATCTGATGTTGACCCGCCCGGAAAAAATGGACGCTACGT
GGTTCGCCACCACGCTGATGCAGGACTGGCCGCAGCGCTCAGGCATCGCTGACGCCGTCTGGCAGGGCAG
CGGCCCTTCGCTGCTGGCATTTTATGCCGCCAGCCTGGCATCGCATCCGCAGTGGCGTCTGCCTGTCGAT
GACGGTCTGGTCAGCCAGGTGCGCACACGGTTAATTCGCCAACTGGGCCAGCGTAACAGTGAGTCCACGC
TTTACCAGAAGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGCGGATATGACTGCCGA
CACCGATGCTTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGCATGTTTACCCGTCAGGCCTGGGAG
CAGGCCGTGCAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGGACTGGGTGTTGAGCG
ATACGAAGCAGACTGCCGCGCAGTCGACGTCGCCGGAAGCTCTGCGAGCCAGGCTGGCGGAGCGTTATTT
CGCTGATTTTAGCGGCGCCTGGCTGGATTTCCTCAACAGTCTGCGCTGGCAGCGCGCGGCGACCCTCTCC
GATGCTATCGACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGGCGCTGATGAACACCC
TGAGCGTGCAGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGTCAAATCGGCCAGGCA
GCTGTTTAACCGTGATAACTCGCCCGTCATCGATCAACGGTCCGGCGCGCGCGGTCCTCTGGATGCCACC
TTCGGACCCGTGCTGGCGCTGCTGGACAATCGCGACGGCGGGACGCCCACCAGCCGTCTTAGCCTGCAGA
CCTTCCTGACCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGCCACCGACCCGCAGGC
GATGACCCGCCTGCTTGCGCAGACGGTATTCCAGGGCAAGGCCGTGGATTTAACCAAAACGCGCGACTAC
GGCAGCCTGGTGGCGGCGGGGCTGGGCCAGGAGTGGAGTGGATTTGGGCAAACGCTGTTTGTTCGCCCGA
TGGAACAGGCCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGTCTCAACGCCCAGTGGCGCAGCGCGGT
GGTGGAGGACTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAATACCAGCAGTGAAGTCTCTCTG
CCGCTGCTGGCAAAATACCTCGACAGCGAGACCGGGCGCATCGCCCGCTTTCTGCAGACCCGGCTGAACG
GCGTGCTGCATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGCCCAGGGGCTGACGTTTAACCC
GGCCTTTCTGCAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCGTTCGCCAACGGCGAAGCGGGA
TTGCATTTTGCGCTACGTCCCGGCACCGCGGACGGCGTGATGCAGACGGAGCTGGTCATCGACAGTCAGA
AACTTGTCTATATGAACCAGATGCCGGTCTGGCGGCGGTTCAGCTGGCCCGCTGACACCGAAGCGCCGGG
CGCCAGTCTGAGCTGGATCAGTACCCGTGCGGGCACCCGCCAGTATGGCGATTTCCCGGGCGCCTGGGGG
TGGATCCGTCTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGAGCAGCAGCTGGAGCCTGAGCT
GGAAAGCGCCGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGCGGGGGAAGGACCGCTGGCGCT
GCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGCGCGTCTGCTGAACGTGTTCCGCTGACCGAC
GATATACCCGGCGAAGAGGGATACTGA
 Primer design